Melanoma antigen family C2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Melanoma antigen family C2 Antibody [NBP2-34145] - Staining of human cell line SK-MEL-30 shows localization to nucleus & nucleoli.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Melanoma antigen family C2 Antibody [NBP2-34145] - Staining in human testis and endometrium tissues using anti-MAGEC2 antibody. Corresponding MAGEC2 RNA-seq ...read more
Immunohistochemistry-Paraffin: Melanoma antigen family C2 Antibody [NBP2-34145] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: Melanoma antigen family C2 Antibody [NBP2-34145] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Melanoma antigen family C2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PVPGVPFRNVDNDSPTSVELEDWVDAQHPTDEEEEEASSASSTLYLVFSPS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAGEC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Melanoma antigen family C2 Protein (NBP2-34145PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Melanoma antigen family C2 Antibody

  • Cancer/testis antigen 10
  • CT10MAGE-E1 antigen
  • HCA587MAGE-C2
  • hepatocellular cancer antigen 587
  • Hepatocellular carcinoma-associated antigen 587
  • MAGE-C2 antigen
  • MAGEE1MGC13377
  • melanoma antigen family C, 2
  • melanoma antigen, family E, 1, cancer/testis specific
  • melanoma-associated antigen C2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85397
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-47714
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00004102-M01
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
H00006757-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP2-49659
Species: Hu
Applications: IHC, IHC-P
NB300-229
Species: Ch, Hu(-), Ma, Pm, Mu, Pa, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP1-84354
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-34754
Species: Ca, Hu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P
NBP2-41318
Species: Hu, Mu, Rt
Applications: ELISA, ICC, IF, IHC, IHC-P, WB
NBP2-46702
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00532
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
AF5414
Species: Hu
Applications: Simple Western, WB

Publications for Melanoma antigen family C2 Antibody (NBP2-34145) (0)

There are no publications for Melanoma antigen family C2 Antibody (NBP2-34145).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Melanoma antigen family C2 Antibody (NBP2-34145) (0)

There are no reviews for Melanoma antigen family C2 Antibody (NBP2-34145). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Melanoma antigen family C2 Antibody (NBP2-34145) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Melanoma antigen family C2 Products

Bioinformatics Tool for Melanoma antigen family C2 Antibody (NBP2-34145)

Discover related pathways, diseases and genes to Melanoma antigen family C2 Antibody (NBP2-34145). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Melanoma antigen family C2 Antibody (NBP2-34145)

Discover more about diseases related to Melanoma antigen family C2 Antibody (NBP2-34145).
 

Pathways for Melanoma antigen family C2 Antibody (NBP2-34145)

View related products by pathway.

PTMs for Melanoma antigen family C2 Antibody (NBP2-34145)

Learn more about PTMs related to Melanoma antigen family C2 Antibody (NBP2-34145).

Blogs on Melanoma antigen family C2

There are no specific blogs for Melanoma antigen family C2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Melanoma antigen family C2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEC2
Uniprot