Melanoma antigen family C2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Melanoma antigen family C2 Antibody [NBP2-34145] - Staining of human cell line SK-MEL-30 shows localization to nucleus & nucleoli.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Melanoma antigen family C2 Antibody [NBP2-34145] - Staining in human testis and endometrium tissues using anti-MAGEC2 antibody. Corresponding MAGEC2 RNA-seq ...read more
Immunohistochemistry-Paraffin: Melanoma antigen family C2 Antibody [NBP2-34145] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: Melanoma antigen family C2 Antibody [NBP2-34145] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Melanoma antigen family C2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PVPGVPFRNVDNDSPTSVELEDWVDAQHPTDEEEEEASSASSTLYLVFSPS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAGEC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Melanoma antigen family C2 Protein (NBP2-34145PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Melanoma antigen family C2 Antibody

  • Cancer/testis antigen 10
  • CT10MAGE-E1 antigen
  • HCA587MAGE-C2
  • hepatocellular cancer antigen 587
  • Hepatocellular carcinoma-associated antigen 587
  • MAGE-C2 antigen
  • MAGEE1MGC13377
  • melanoma antigen family C, 2
  • melanoma antigen, family E, 1, cancer/testis specific
  • melanoma-associated antigen C2

Background

Melanoma antigen family C2 is related to members of the MAGEC gene family. It is not expressed in normal tissues, except for testis, and is expressed in tumors of various histological types. This gene and the MAGEC genes are clustered on chromosome Xq26-q27. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Melanoma antigen family C2 Antibody (NBP2-34145) (0)

There are no publications for Melanoma antigen family C2 Antibody (NBP2-34145).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Melanoma antigen family C2 Antibody (NBP2-34145) (0)

There are no reviews for Melanoma antigen family C2 Antibody (NBP2-34145). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Melanoma antigen family C2 Antibody (NBP2-34145) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Melanoma antigen family C2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEC2
Uniprot