MAGEA11 Recombinant Protein Antigen

Images

 
There are currently no images for MAGEA11 Recombinant Protein Antigen (NBP2-55827PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MAGEA11 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAGEA11.

Source: E. coli

Amino Acid Sequence: PSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MAGEA11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55827.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MAGEA11 Recombinant Protein Antigen

  • Cancer/testis antigen 1.11
  • CT1.11
  • CT1.11MAGE-11 antigen
  • MAGE-11 antigen
  • MAGE11
  • MAGE11member 11
  • MAGEA11
  • MAGEA-11
  • melanoma antigen family A, 11
  • melanoma-associated antigen 11
  • MGC10511

Background

MAGEA11 is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
262-AR
Species: Hu
Applications: BA
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
NBP1-83319
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-61050
Species: Hu
Applications: IHC,  IHC-P, IP, PLA, WB
NB200-331
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB100-137
Species: Hu, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, KD, KO, Simple Western, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
236-EG
Species: Hu
Applications: BA
NBP3-20167
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IP, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-38158
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-51531
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
NB100-2385
Species: Bv, Hu, Po
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-55827PEP
Species: Hu
Applications: AC

Publications for MAGEA11 Recombinant Protein Antigen (NBP2-55827PEP) (0)

There are no publications for MAGEA11 Recombinant Protein Antigen (NBP2-55827PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGEA11 Recombinant Protein Antigen (NBP2-55827PEP) (0)

There are no reviews for MAGEA11 Recombinant Protein Antigen (NBP2-55827PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MAGEA11 Recombinant Protein Antigen (NBP2-55827PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAGEA11 Products

Research Areas for MAGEA11 Recombinant Protein Antigen (NBP2-55827PEP)

Find related products by research area.

Blogs on MAGEA11

There are no specific blogs for MAGEA11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MAGEA11 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEA11