MafG Antibody - BSA Free

Western Blot: MafG Antibody [NBP2-82278] - WB Suggested Anti-Mafg Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Muscle

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MafG Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MafG Antibody - BSA Free (NBP2-82278) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Mafg. Peptide sequence: TPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIIQL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAFG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 18 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MafG Antibody - BSA Free

• basic leucine zipper transcription factor MafG
• hMAF
• MafG
• MGC13090
• MGC20149
• transcription factor MafG
• v-maf musculoaponeurotic fibrosarcoma (avian) oncogene family, protein G
• v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian)
• V-maf musculoaponeurotic fibrosarcoma oncogene homolog G

Background

Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they seem to serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins and recruiting them to specific DNA-binding sites. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NF-E2 transcription factor. Transcription factor, component of erythroid-specific transcription factor NF-E2. Activates globin gene expression when associated with NF-E2. May be involved in signal transduction of extracellular H(+)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAFG