Home » MAD4 » MAD4 Proteins » MAD4 Recombinant Protein Antigen

MAD4 Recombinant Protein Antigen

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related MAD4 Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-58767PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MAD4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAD4.

Source: E.coli

Amino Acid Sequence: HGYASVLPFDGDFAREKTKAAGLVRKAPNNRSSHNEL
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MXD4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-58767 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for MAD4 Recombinant Protein Antigen

  • BHLHC12
  • bHLHc12Max-interacting transcriptional repressor MAD4
  • Class C basic helix-loop-helix protein 12
  • Mad4 homolog
  • MAD4Max-associated protein 4
  • MAX dimerization protein 4
  • Max dimerizer 4
  • MST149
  • MSTP149
  • MXD4 MAX dimerization protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

c-Myc Antibody
NB600-335
Western Blot: c-Myc Antibody [NB600-335] - Detection of c-myc-tagged Protein by Western Blot. Samples: 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibodies: Affinity purified, goat anti-c-myc antibody NB600-335 used for WB at 0.04 ug/ml (1:25,000). Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunocytochemistry/Immunofluorescence: c-Myc Antibody [NB600-335] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-c-Myc conjugated to Alexa Fluor 488 [NB600-335AF488] at 20ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective. Image using the Alexa Fluor 488 format of this antibody.
Western Blot: c-Myc Antibody [NB600-335] - Analysis using the HRP conjugate of NB600-335. Detection of 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibody used for WB at 0.4 ug/ml (1:25,000).
(1 Review)
(48 Publications)
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Mad Antibody
NBP1-89979
Immunohistochemistry-Paraffin: Mad Antibody [NBP1-89979] - Staining in human bone marrow and liver tissues using anti-MXD1 antibody. Corresponding MXD1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Mad Antibody [NBP1-89979] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: Mad Antibody [NBP1-89979] - Staining of human liver shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P
Max Antibody
NB100-793
Western Blot: Max Antibody [NB100-793] - Staining of Jurkat lysate (35 ug protein in RIPA buffer). Antibody at 0.01 ug/mL. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: Max Antibody [NB100-793] - Staining of Prostate. Antibody at 10 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunofluorescence: Max Antibody [NB100-793] - Immunofluorescence analysis of paraformaldehyde fixed A431 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing cytoplasmic and nuclear staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(3 Publications)
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA, IF
MAD1L1/MAD1
Antibody
NBP1-32775
Western Blot: MAD1L1/MAD1 Antibody [NBP1-32775] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with MAD1 antibody diluted by 1:5000.
Immunocytochemistry/Immunofluorescence: MAD1L1/MAD1 Antibody [NBP1-32775] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: MAD1 protein stained by MAD1 antibody diluted at 1:500. Red: HEC1, a kinetochore marker, stained by HEC1 antibody [9G3.23] diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: MAD1L1/MAD1 Antibody [NBP1-32775] - Paraffin-embedded SW480 Xenograft, using antibody at 1:100 dilution.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AMPD1 Antibody
NBP2-24509
Western Blot: AMPD1 Antibody [NBP2-24509] - Analysis of human AMPDA1 in mouse skeletal muscle lysate in the 1) absence, 2) presence of immunizing peptide and 3) rat skeletal muscle using NBP2-24509 at 1 ug/ml.
Immunohistochemistry-Paraffin: AMPD1 Antibody [NBP2-24509] - Analysis of human skeletal muscle using NBP2-24509 at 10 ug/ml.
(1 Publication)
Species: Hu, Mu, Rt, Bv, Ca, Ma-Op, Pm
Applications: WB, IHC, IHC-P
Mxi1 Antibody
NBP1-88626
Immunohistochemistry-Paraffin: Mxi1 Antibody [NBP1-88626] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: Mxi1 Antibody [NBP1-88626] - Staining of human colon shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: Mxi1 Antibody [NBP1-88626] - Staining of human skin shows moderate to strong nuclear positivity in epidermal cells.
Species: Hu
Applications: IHC, IHC-P
Smad3 Antibody
NB100-56479
Western Blot: Smad3 Antibody [NB100-56479] - Analysis in human fibroblast and HeLa whole cell lysates. Untreated lysates show a band around 55 Kda. 1:1000 dilution, 1 hour blocking in milk 5%. Image from a verified customer review.
Immunocytochemistry/Immunofluorescence: Smad3 Antibody [NB100-56479] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-Smad3 at 10 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Smad3 Antibody [NB100-56479] - Human liver tissue probed with SMAD3 antibody (bottom left, right) and isotype control antibody (top left) at 10 ug/ml.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
IkB-alpha Antibody
(6A920)
NB100-56507
Knockout Validated: IkB-alpha Antibody (6A920) [NB100-56507] - Western blot shows lysates of HEK293 human embryonic kidney parental cell line and IkB-alpha knockout (KO) HEK293 human embryonic kidney cell line. PVDF membrane was probed with 2 ug/ml of Mouse Anti-Human IkB-alpha monoclonal Antibody (Catalog # NB100-56507) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody. Specific band was detected for IkB-alpha at approximately 38 kDa (as indicated) in the parental HEK293 celll line, but is not detectable in the knockout HEK293 cell line. This experiment was conducted under reducing conditions.
Western Blot: IkB-alpha Antibody (6A920) [NB100-56507] - Lysates of Jurkat human acute T cell leukemia cell line, LNCaP human prostate cancer cell line, PCx2011;3 human prostate cancer cell line, HeLa human cervical epithelial carcinoma cell line, and NIHx2011;3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 0.5 ug/mL mouse anti-IkB-a monoclonal (NB100-56507, Novus Biologicals), followed by 1:2000 dilution of the appropriate HRP-conjugated secondary antibody, donkey anti-mouse IgG.
Immunocytochemistry/Immunofluorescence: IkB-alpha Antibody (6A920) [NB100-56507] - Hek293 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-IkB-alpha (6A920) at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(37 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
MAD3 Antibody
NB100-1116
MAD3 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
MAX binding
protein Antibody
NBP2-04053
Immunoprecipitation: MAX binding protein Antibody [NBP2-04053] - Samples: Whole cell lysate from HeLa (15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 ug) and Jurkat (J; 50 ug) cells. Antibodies: Affinity purified rabbit anti-MNT antibody NBP2-04052 used for WB at 0.1 ug/ml (A) and 1 ug/ml (B) and used for IP at 6 ug/mg lysate. MNT was also immunoprecipitated by rabbit anti-MNT antibody NBP2-04053, which recognizes a downstream epitope. Detection: Chemiluminescence with exposure times of 3 minutes (A) and 10 seconds (B).
Species: Hu
Applications: WB, IP
MLX Antibody
[Unconjugated]
AF4186
Western blot shows nuclear extracts of PC‑3 human prostate cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human MLX Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4186) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for MLX at approximately 30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
(1 Publication)
Species: Hu
Applications: WB, ICC
Miz-1/ZBTB17
Antibody
AF3760
Western blot shows lysates of Raji human Burkitt's lymphoma cell line and CEM human T-lymphoblastoid cell line. PVDF membrane was probed with 1 µg/mL of Human Miz‑1/ZBTB17 Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3760) followed by HRP‑conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Miz-1/ZBTB17 at approximately 100 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: WB
Smad4 Antibody
NBP2-24951
Western Blot: SMAD4 Antibody [NBP2-24951] - Analysis using SMAD4 antibody. Lysate from A549 cells probed with SMAD4 antibody at 2 ug/ml.
Immunocytochemistry/Immunofluorescence: Smad4 Antibody [NBP2-24951] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-SMAD4 Antibody NBP2-24951 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunohistochemistry-Paraffin: Smad4 Antibody [NBP2-24951] - Analysis of a FFPE tissue section of human colon using 1:200 dilution of SMAD4 antibody. The staining was developed using HRP labeled anti-rabbit secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. Apical cytoplasmic staining was observed in both glandular and epithelial cells.
(2 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
n-Myc Antibody
(NMYC-1)
NB200-109
Western Blot: n-Myc Antibody (NMYC-1) [NB200-109] - Analysis of n-Myc expression in IMR32 whole cell lysate.
Immunocytochemistry/Immunofluorescence: n-Myc Antibody (NMYC-1) [NB200-109] - The n-Myc (NMYC-1) antibody was tested in NTERA2 cells at a 1:50 dilution against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 568 (Red) and DAPI (Blue), respectively.
Western Blot: n-Myc Antibody (NMYC-1) [NB200-109] - Analysis of n-Myc expression in human heart tissue.
(5 Publications)
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
OX40/TNFRSF4
Antibody [Unconjugate
AF3388
OX40/TNFRSF4 was detected in immersion fixed paraffin-embedded sections of human tonsil using Sheep Anti-Human OX40/TNFRSF4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3388) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Sheep IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC006). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Recombinant Human OX40L/TNFSF4 (Catalog # 1054-OX) stimulates CXCL8/IL-8 secretion in the HT1080 human fibrosarcoma cell line transfected with human OX40/TNFRSF4 in a dose-dependent manner (orange line), as measured by the Human CXCL8/IL-8 Quantikine ELISA Kit (Catalog # D8000C). CXCL8/Il-8 Secretion elicited by Recombinant Human OX40L/TNFSF4 (10 ng/mL) is neutralized (green line) by increasing concentrations of Sheep Anti-Human OX40/TNFRSF4 Polyclonal Antibody (Catalog # AF3388). The ND50 is typically 0.025-0.16 µg/mL.
Human T cells were treated for 3‑5 days with 1 μg/mL PHA then stained with Sheep Anti-Human OX40/TNFRSF4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3388, filled histogram) or control antibody (Catalog # 5-001-A, open histogram), followed by NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # NL010).
(1 Review)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
Ornithine
Decarboxylase Antibod ...
NBP2-32887
Western Blot: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - Analysis using the Azide and BSA Free version of NBP2-32887. Detection of ODC1 in human placental lysate
Immunocytochemistry/Immunofluorescence: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - IF staining of LNCap cells using AF488 labeled ODC1 Monoclonal Antibody (ODC1/485) (GREEN) DAPI was used to stain the cell nucleus (blue). Image using the Azide and BSA Free format of this antibody.
Immunohistochemistry-Paraffin: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - Formalin-fixed, paraffin-embedded Mouse Pancreas stained with Ornithine Decarboxylase Antibody (ODC1/485).
(1 Review)
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
BLIMP1/PRDM1
Antibody (3H2-E8)
NB600-235
Western Blot: BLIMP1/PRDM1 Antibody (3H2-E8) [NB600-235] - The effect of IL-21 and CD40L exposure on MEC1 and MEC2 cells. Expression of EBNA-2 and LMP-1 in IL-21 treated cells. Expression of EBNA-2, LMP-1 and Blimp-1 by immunoblotting; positive control: CBM1-Ral-STO, negative control: Ramos. 1.5x105 cells were loaded in the control lanes and 5x105 were loaded in both untreated and IL-21 treated MEC1 and MEC2 lanes. Note low expression of EBNA-2 and high expression of LMP-1 after IL-21 treatment and induction of Blimp-1 after IL-21 treatment. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0106008), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: BLIMP1/PRDM1 Antibody (3H2-E8) [NB600-235] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-BLIMP1 (3H2-E8) at 10 ug/ml overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: BLIMP1/PRDM1 Antibody (3H2-E8) [NB600-235] - Analysis using paraffin-embedded human tonsil tissue with BLIMP1/PRDM1 antibody at dilution of 1:50. Detection is completed through VC001 (DAB) and Counterstained by hematoxylin; labeling is predominantly in germinal centers. Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(2 Reviews)
(49 Publications)
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
CHREBP Antibody
NB400-135
Western Blot: CHREBP Antibody [NB400-135] - Detection of ChREBP in liver nuclear extracts from well-fed rats. 7% SDS-PAGE gel, 1:1000 dilution of NB400-135. Photo courtesy of Dr. Uyeda, UT Southwestern University.
Immunohistochemistry: CHREBP Antibody [NB400-135] - Analysis of CHREBP in mouse liver using DAB with hematoxylin counterstain.
Western Blot: CHREBP Antibody [NB400-135] - Protein expression levels of carbohydrate-responsive element-binding protein (ChREBP), in livers of rats receiving normal water (CON), a 13% (w/v) glucose solution (GLU), a 13% (w/v) fructose solution (FRUC), or a 0.4% (w/v) aspartame solution (n = 6 per diet group). All data were normalized to beta-actin expression levels and are expressed relative to the controls (CON). Data are expressed as means +/- SEM. * p < 0.05, ** p < 0.01, *** p < 0.001 vs. CON; +p < 0.05, ++p < 0.01, +++p < 0.001 vs. ASP; p < 0.01, p < 0.001 vs. GLU. Image collected and cropped by CiteAb from the following publication (http://www.mdpi.com/2072-6643/9/5/476), licensed under a CC-BY licence.
(6 Reviews)
(110 Publications)
Species: Hu, Mu, Rt
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP, KO
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(28 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAD4 Recombinant
Protein Antigen
NBP2-58767PEP
MAD4 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for MAD4 Recombinant Protein Antigen (NBP2-58767PEP) (0)

There are no publications for MAD4 Recombinant Protein Antigen (NBP2-58767PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAD4 Recombinant Protein Antigen (NBP2-58767PEP) (0)

There are no reviews for MAD4 Recombinant Protein Antigen (NBP2-58767PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MAD4 Recombinant Protein Antigen (NBP2-58767PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional MAD4 Products

Bioinformatics Tool for MAD4 Recombinant Protein Antigen (NBP2-58767PEP)

Discover related pathways, diseases and genes to MAD4 Recombinant Protein Antigen (NBP2-58767PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAD4 Recombinant Protein Antigen (NBP2-58767PEP)

Discover more about diseases related to MAD4 Recombinant Protein Antigen (NBP2-58767PEP).
 

Pathways for MAD4 Recombinant Protein Antigen (NBP2-58767PEP)

View related products by pathway.

PTMs for MAD4 Recombinant Protein Antigen (NBP2-58767PEP)

Learn more about PTMs related to MAD4 Recombinant Protein Antigen (NBP2-58767PEP).
 

Research Areas for MAD4 Recombinant Protein Antigen (NBP2-58767PEP)

Find related products by research area.

Blogs on MAD4

There are no specific blogs for MAD4, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MAD4 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MXD4