MAD4 Antibody

Western Blot: MAD4 Antibody [NBP2-58767] - Analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: MAD4 Antibody [NBP2-58767] - Staining of human cell line HEK 293 shows localization to cytosol.

Product Discontinued

MAD4 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HGYASVLPFDGDFAREKTKAAGLVRKAPNNRSSHNEL
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MXD4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MAD4 Antibody

• BHLHC12
• bHLHc12Max-interacting transcriptional repressor MAD4
• Class C basic helix-loop-helix protein 12
• Mad4 homolog
• MAD4Max-associated protein 4
• MAX dimerization protein 4
• Max dimerizer 4
• MST149
• MSTP149
• MXD4 MAX dimerization protein 4

Background

MAD4 is a member of the MAD gene family . The MAD genes encode basic helix loop helix leucine zipper proteins that heterodimerize with MAX protein, forming a transcriptional repression complex. The MAD proteins compete for MAX binding with MYC, which heterodimerizes with MAX forming a transcriptional activation complex. Studies in rodents suggest that the MAD genes are tumor suppressors and contribute to the regulation of cell growth in differentiating tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MXD4