MAD3 Antibody (8M7B3)

Western Blot: MAD3 Antibody (8M7B3) [NBP3-15929] - Western blot analysis of extracts of various cell lines, using MAD3 Rabbit mAb (NBP3-15929) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

• Reactivity: Hu
• Applications: WB
• Clone: 8M7B3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

MAD3 Antibody (8M7B3) Summary

• Description: Novus Biologicals Rabbit MAD3 Antibody (8M7B3) (NBP3-15929) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-190 of human MAD3 (Q9BW11). RRARMHIQKLEDQEQRARQLKERLRSKQQSLQRQLEQLRGLAGAAERERLRADSLDSSGLSSERSDSDQEELEVDVESLVFGGEAELLRGF
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: MXD3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MAD3 Antibody (8M7B3)

• bHLHc13
• Class C basic helix-loop-helix protein 13
• MAD3FLJ35523
• MAX dimerization protein 3
• Max dimerizer 3
• Max-associated protein 3
• Max-interacting transcriptional repressor MAD3
• MGC2383
• MYX

Background

The MAD3 gene encodes a member of the Myc superfamily of basic helix-loop-helix leucine zipper transcriptional regulators.The encoded protein forms a heterodimer with the cofactor MAX which binds specific E-box DNA motifs in the promotersof target genes and r

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MXD3