MAD2L2 Antibody - Azide and BSA Free

Western Blot: MAD2L2 Antibody [H00010459-B02P] - Analysis of MAD2L2 expression in transfected 293T cell line by MAD2L2 polyclonal antibody. Lane 1: MAD2L2 transfected lysate(23.21 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MAD2L2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse MAD2L2 Antibody - Azide and BSA Free (H00010459-B02P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: MAD2L2 (AAH15244.1, 1 a.a. - 211 a.a.) full-length human protein. MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS
• Specificity: MAD2L2 - MAD2 mitotic arrest deficient-like 2 (yeast),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: MAD2L2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag in Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. This product is also useful for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MAD2L2 Antibody - Azide and BSA Free

• hREV7
• MAD2 mitotic arrest deficient-like 2 (yeast)
• MAD2BREV7 homolog
• MAD2-like protein 2
• Mitotic arrest deficient 2-like protein 2
• mitotic arrest deficient homolog-like 2
• mitotic spindle assembly checkpoint protein MAD2B
• REV7yeast, homolog)-like 2

Background

The protein encoded by this gene is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. The encoded protein, which is similar to MAD2L1, is capable of interacting with ADAM9, ADAM15, REV1, and REV3 proteins. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAD2L2
• Entrez:
  • 10459(Human)
• Uniprot:
  • AAH15244.1(Human)