MAD2L1 Recombinant Protein Antigen

Images

 
There are currently no images for MAD2L1 Protein (NBP1-83185PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MAD2L1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAD2L1.

Source: E.coli

Amino Acid Sequence: NNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIH

Protein/Peptide Type
Recombinant Protein Antigen
Gene
MAD2L1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83185.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MAD2L1 Recombinant Protein Antigen

  • HSMAD2
  • MAD2 (mitotic arrest deficient, yeast, homolog)-like 1
  • MAD2 mitotic arrest deficient-like 1 (yeast)
  • MAD2L1
  • MAD2-like protein 1
  • MAD2mitotic arrest deficient, yeast, homolog-like 1
  • Mitotic arrest deficient 2-like protein 1
  • mitotic spindle assembly checkpoint protein MAD2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP1-88517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF6028
Species: Hu
Applications: WB, IHC
NB100-1103
Species: Hu
Applications: WB, PEP-ELISA
NBP2-20287
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
H00010459-D01P
Species: Hu
Applications: WB, ELISA
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-1116
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA

Publications for MAD2L1 Protein (NBP1-83185PEP) (0)

There are no publications for MAD2L1 Protein (NBP1-83185PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAD2L1 Protein (NBP1-83185PEP) (0)

There are no reviews for MAD2L1 Protein (NBP1-83185PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for MAD2L1 Protein (NBP1-83185PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAD2L1 Products

Bioinformatics Tool for MAD2L1 Protein (NBP1-83185PEP)

Discover related pathways, diseases and genes to MAD2L1 Protein (NBP1-83185PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAD2L1 Protein (NBP1-83185PEP)

Discover more about diseases related to MAD2L1 Protein (NBP1-83185PEP).
 

Pathways for MAD2L1 Protein (NBP1-83185PEP)

View related products by pathway.

PTMs for MAD2L1 Protein (NBP1-83185PEP)

Learn more about PTMs related to MAD2L1 Protein (NBP1-83185PEP).
 

Research Areas for MAD2L1 Protein (NBP1-83185PEP)

Find related products by research area.

Blogs on MAD2L1

There are no specific blogs for MAD2L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MAD2L1 Antibody
NB100-563
MAD2L1 Antibody
NB100-563

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MAD2L1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MAD2L1
Entrez