MAD2L1-binding protein Antibody

Images

 
Western Blot: MAD2L1-binding protein Antibody [NBP2-55414] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: MAD2L1-binding protein Antibody [NBP2-55414] - Staining of human cell line MCF7 shows localization to nucleus, nucleoli & nuclear membrane.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAD2L1-binding protein Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PDLEWYEKSEETHASQIELLETSSTQEPLNASEAFCPRDCMVPVVFPGPVSQEGCCQFTCELLKHIMYQRQQLPLPY
Specificity
Specificity of human MAD2L1-binding protein antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAD2L1BP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAD2L1-binding protein Recombinant Protein Antigen (NBP2-55414PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MAD2L1-binding protein Antibody

  • Caught by MAD2 protein
  • CMT2MGC11282
  • dJ261G23.1
  • KIAA0110RP1-261G23.6
  • MAD2L1 binding protein
  • MAD2L1-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP2-67068
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P, RNAi, S-ELISA
NBP2-53381
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr
NBL1-15012
Species: Hu
NB100-57493
Species: Hu, Mu
Applications: WB, IP
NBP1-84430
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-563
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-131
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-85533
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-75477
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88626
Species: Hu
Applications: IHC, IHC-P
NBP1-84945
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-56649
Species: Hu
Applications: WB, ICC/IF, Flow-IC
NBP2-97553
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-59828
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-15520
Species: Hu, Mu, Rt, Ma-Op
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55414
Species: Hu
Applications: WB, ICC/IF

Publications for MAD2L1-binding protein Antibody (NBP2-55414) (0)

There are no publications for MAD2L1-binding protein Antibody (NBP2-55414).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAD2L1-binding protein Antibody (NBP2-55414) (0)

There are no reviews for MAD2L1-binding protein Antibody (NBP2-55414). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MAD2L1-binding protein Antibody (NBP2-55414) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MAD2L1-binding protein Products

Bioinformatics Tool for MAD2L1-binding protein Antibody (NBP2-55414)

Discover related pathways, diseases and genes to MAD2L1-binding protein Antibody (NBP2-55414). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAD2L1-binding protein Antibody (NBP2-55414)

Discover more about diseases related to MAD2L1-binding protein Antibody (NBP2-55414).
 

Pathways for MAD2L1-binding protein Antibody (NBP2-55414)

View related products by pathway.

PTMs for MAD2L1-binding protein Antibody (NBP2-55414)

Learn more about PTMs related to MAD2L1-binding protein Antibody (NBP2-55414).
 

Research Areas for MAD2L1-binding protein Antibody (NBP2-55414)

Find related products by research area.

Blogs on MAD2L1-binding protein

There are no specific blogs for MAD2L1-binding protein, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAD2L1-binding protein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAD2L1BP