Mad Antibody - BSA Free

Western Blot: Mad Antibody [NBP3-10418] - Western blot analysis using NBP3-10418 on Mouse Spleen as a positive control. Antibody Titration: 0.2-1 ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Mad Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Mad Antibody - BSA Free (NBP3-10418) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_034881). Peptide sequence TQLKDTECTPVGGPLSLEQVQNGNDTPTQVEYQEAPETQVKARHKEGANQ
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MXD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Mad Antibody - BSA Free

• antagonizer of myc transcriptional activity
• bHLHc58
• MADMAD1
• MAX dimerization protein 1
• Max dimerizer 1
• MAX-binding protein
• MGC104659
• Protein MAD

Background

MAX dimerization protein belongs to a subfamily of MAX-interacting proteins. This protein competes with MYC for binding to MAX to form a sequence-specific DNA-binding complex, acts as a transcriptional repressor (while MYC appears to function as an activator) and is a candidate tumor suppressor. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MXD1