Mad Antibody


Western Blot: Mad Antibody [NBP2-85249] - Host: Mouse. Target Name: MXD1. Sample Tissue: Mouse Small Intestine. Antibody Dilution: 1ug/ml
Western Blot: Mad Antibody [NBP2-85249] - WB Suggested Anti-MXD1 Antibody Titration: 0.2-1 ug/ml. Positive Control: Human Muscle
Western Blot: Mad Antibody [NBP2-85249] - Host: Rabbit. Target: MXD1. Positive control (+): Mouse small intestine (M-IN). Negative control (-): Mouse testis (M-TE). Antibody concentration: 1ug/ml

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB
0.5 mg/ml

Order Details

Mad Antibody Summary

The immunogen is a synthetic peptide directed towards the N-terminal region of human Mad. Peptide sequence: MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKS The peptide sequence for this immunogen was taken from within the described region.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
0.5 mg/ml
Affinity purified

Alternate Names for Mad Antibody

  • antagonizer of myc transcriptional activity
  • bHLHc58
  • MAX dimerization protein 1
  • Max dimerizer 1
  • MAX-binding protein
  • MGC104659
  • Protein MAD


MAX dimerization protein belongs to a subfamily of MAX-interacting proteins. This protein competes with MYC for binding to MAX to form a sequence-specific DNA-binding complex, acts as a transcriptional repressor (while MYC appears to function as an activator) and is a candidate tumor suppressor. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu, Rt
Applications: IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: Flow, ICC/IF, PA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, PLA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IP, WB
Species: Hu, Mu
Applications: WB

Publications for Mad Antibody (NBP2-85249) (0)

There are no publications for Mad Antibody (NBP2-85249).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mad Antibody (NBP2-85249) (0)

There are no reviews for Mad Antibody (NBP2-85249). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mad Antibody (NBP2-85249) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Mad Products

Array NBP2-85249

Diseases for Mad Antibody (NBP2-85249)

Discover more about diseases related to Mad Antibody (NBP2-85249).

Pathways for Mad Antibody (NBP2-85249)

View related products by pathway.

PTMs for Mad Antibody (NBP2-85249)

Learn more about PTMs related to Mad Antibody (NBP2-85249).

Research Areas for Mad Antibody (NBP2-85249)

Find related products by research area.

Blogs on Mad.

The c-Myc Antibody: A Major Tool in Cancer Research
C-Myc is a widely expressed transcription factor, regulating cellular differentiation, proliferation, cell cycle progression and pro-apoptotic gene expression. The c-Myc antibody is widely used in cancer research, as a number of human tumors have been...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Mad Antibody and receive a gift card or discount.


Gene Symbol MXD1