Mad Antibody

Images

 
Western Blot: Mad Antibody [NBP2-85249] - Host: Mouse. Target Name: MXD1. Sample Tissue: Mouse Small Intestine. Antibody Dilution: 1ug/ml
Western Blot: Mad Antibody [NBP2-85249] - WB Suggested Anti-MXD1 Antibody Titration: 0.2-1 ug/ml. Positive Control: Human Muscle
Western Blot: Mad Antibody [NBP2-85249] - Host: Rabbit. Target: MXD1. Positive control (+): Mouse small intestine (M-IN). Negative control (-): Mouse testis (M-TE). Antibody concentration: 1ug/ml

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Mad Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human Mad. Peptide sequence: MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
MXD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Mad Antibody

  • antagonizer of myc transcriptional activity
  • bHLHc58
  • MADMAD1
  • MAX dimerization protein 1
  • Max dimerizer 1
  • MAX-binding protein
  • MGC104659
  • Protein MAD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NB100-793
Species: Hu, Rt
Applications: IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-97478
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-563
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-32775
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NB100-56479
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92546
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-24951
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-15929
Species: Hu, Mu, Rt
Applications: WB
NB100-56507
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
H00004335-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00000699-D01P
Species: Hu, Mu
Applications: ICC/IF, PLA, WB
NBP1-88517
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF2039
Species: Hu
Applications: IHC, Simple Western, WB
NB100-58824
Species: Hu, Mu
Applications: CHIP-SEQ, ChIP, IP, WB
NBP2-85249
Species: Hu, Mu
Applications: WB

Publications for Mad Antibody (NBP2-85249) (0)

There are no publications for Mad Antibody (NBP2-85249).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mad Antibody (NBP2-85249) (0)

There are no reviews for Mad Antibody (NBP2-85249). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mad Antibody (NBP2-85249) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Mad Products

Array NBP2-85249

Bioinformatics Tool for Mad Antibody (NBP2-85249)

Discover related pathways, diseases and genes to Mad Antibody (NBP2-85249). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mad Antibody (NBP2-85249)

Discover more about diseases related to Mad Antibody (NBP2-85249).
 

Pathways for Mad Antibody (NBP2-85249)

View related products by pathway.

PTMs for Mad Antibody (NBP2-85249)

Learn more about PTMs related to Mad Antibody (NBP2-85249).
 

Research Areas for Mad Antibody (NBP2-85249)

Find related products by research area.

Blogs on Mad.

The c-Myc Antibody: A Major Tool in Cancer Research
C-Myc is a widely expressed transcription factor, regulating cellular differentiation, proliferation, cell cycle progression and pro-apoptotic gene expression. The c-Myc antibody is widely used in cancer research, as a number of human tumors have been...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mad Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MXD1