Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQK |
| Predicted Species |
Mouse (95%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KDM4C |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody - BSA Free
Background
JMJD2C is a member of the Jumonji domain 2 (JMJD2) family and encodes a protein with one JmjC domain, one JmjN domain, two PHD-type zinc fingers, and two Tudor domains. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form. Chromosomal aberrations and increased transcriptional expression of this gene are associated with esophageal squamous cell carcinoma.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu, Mu, Pm
Applications: ChIP, ELISA, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Mu
Applications: IP, KD, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IP, KO, WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ChIP, ChIP, ICC/IF (-), WB
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: CHIP-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF
Publications for Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody (NBP2-57484) (0)
There are no publications for Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody (NBP2-57484).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody (NBP2-57484) (0)
There are no reviews for Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody (NBP2-57484).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody (NBP2-57484) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Products
Research Areas for Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody (NBP2-57484)
Find related products by research area.
|
Blogs on Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C