Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody (9A9G6) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 550-650 of human Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A (O75164). GDGRVTVGEPCTRKKGSAARSFSERELAEVADEYMFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPN |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
KDM4A |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody (9A9G6)
Background
JMJD2A is a member of the Jumonji domain 2 (JMJD2) family and encodes a protein with a JmjN domain, a JmjC domain, a JD2H domain, two TUDOR domains, and two PHD-type zinc fingers. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form, and as a transcriptional repressor.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu
Applications: IP, KD, WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Pm
Applications: ChIP, ELISA, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: ChIP, ChIP, ICC/IF (-), WB
Species: Bt, Bv, Ca, Fi, Gt, Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ISH, KD, KO, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: Flow-IC, ICC/IF, WB
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
Species: Hu
Applications: ELISA
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IP, KO, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Publications for Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody (NBP3-16799) (0)
There are no publications for Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody (NBP3-16799).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody (NBP3-16799) (0)
There are no reviews for Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody (NBP3-16799).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody (NBP3-16799) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Products
Research Areas for Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody (NBP3-16799)
Find related products by research area.
|
Blogs on Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A