LYRIC Antibody

Images

 
Independent Antibodies: Western Blot: LYRIC Antibody [NBP1-90327] - Analysis using Anti-MTDH antibody NBP1-90327 (A) shows similar pattern to independent antibody NBP1-90328 (B).
Immunocytochemistry/ Immunofluorescence: LYRIC Antibody [NBP1-90327] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: LYRIC Antibody [NBP1-90327] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in purkinje cells.
Immunohistochemistry-Paraffin: LYRIC Antibody [NBP1-90327] - Staining of human small intestine shows nuclear and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: LYRIC Antibody [NBP1-90327] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: LYRIC Antibody [NBP1-90327] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in non - germinal center cells.
Immunohistochemistry-Paraffin: LYRIC Antibody [NBP1-90327] - Staining of human placenta shows moderate to strong cytoplasmic positivity in decidual cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

LYRIC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NSSRHDGKEVDEGAWETKISHREKRQQRKRDKVLTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLTVNGGGWNEKSVKLSSQISAGEEKWNSVSPA
Specificity
Specificity of human LYRIC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MTDH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Publications
Read Publications using
NBP1-90327 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24963474).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LYRIC Antibody

  • 3D3
  • AEG1
  • AEG-13D3/LYRIC
  • AEG1LYRIC/3D3
  • Astrocyte elevated gene-1 protein
  • LYRIC
  • LYRICMetastasis adhesion protein
  • Lysine-rich CEACAM1 co-isolated protein
  • Metadherin
  • MTDH
  • protein LYRIC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC-P, KO
NBP1-20136
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, In vivo, ISH
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NB100-55408
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46411
Species: Hu
Applications: WB, IHC
NBP2-38535
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00027044-Q01
Species: Hu
NBP1-85047
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
NB100-56566
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
NBP2-29454
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-90327
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LYRIC Antibody (NBP1-90327)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for LYRIC Antibody (NBP1-90327) (0)

There are no reviews for LYRIC Antibody (NBP1-90327). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LYRIC Antibody (NBP1-90327) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LYRIC Products

Bioinformatics Tool for LYRIC Antibody (NBP1-90327)

Discover related pathways, diseases and genes to LYRIC Antibody (NBP1-90327). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LYRIC Antibody (NBP1-90327)

Discover more about diseases related to LYRIC Antibody (NBP1-90327).
 

Pathways for LYRIC Antibody (NBP1-90327)

View related products by pathway.

PTMs for LYRIC Antibody (NBP1-90327)

Learn more about PTMs related to LYRIC Antibody (NBP1-90327).

Blogs on LYRIC

There are no specific blogs for LYRIC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LYRIC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTDH