LYPLAL1 Antibody

Images

 
Western Blot: LYPLAL1 Antibody [NBP2-85246] - WB Suggested Anti-LYPLAL1 Antibody. Titration: 1.0 ug/ml. Positive Control: COLO205 Whole Cell

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LYPLAL1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human LYPLAL1. Peptide sequence: MCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
LYPLAL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LYPLAL1 Antibody

  • EC 3.1.2.-
  • FLJ99730
  • KIAA1238
  • LYPLAL1
  • lysophospholipase-like 1
  • lysophospholipase-like protein 1
  • Q96AV0

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87456
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31344
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00151056-B01P
Species: Hu, Mu
Applications: WB
AF5634
Species: Hu
Applications: WB
NB110-60935
Species: Ch, Hu, Mu, Pm
Applications: IB, IHC, WB
AF5269
Species: Hu, Mu
Applications: IHC, WB
DBD00
Species: Hu
Applications: ELISA
NBP1-83116
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-80466
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-76998
Species: Hu, Mu
Applications: ELISA, IF, IHC, IHC-P, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
NBP2-81843
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-41103
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
NBP1-76997
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
DVE00
Species: Hu
Applications: ELISA
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-77122
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF5365
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
H00079047-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
H00006890-M04
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB

Publications for LYPLAL1 Antibody (NBP2-85246) (0)

There are no publications for LYPLAL1 Antibody (NBP2-85246).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LYPLAL1 Antibody (NBP2-85246) (0)

There are no reviews for LYPLAL1 Antibody (NBP2-85246). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LYPLAL1 Antibody (NBP2-85246) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LYPLAL1 Products

Bioinformatics Tool for LYPLAL1 Antibody (NBP2-85246)

Discover related pathways, diseases and genes to LYPLAL1 Antibody (NBP2-85246). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LYPLAL1 Antibody (NBP2-85246)

Discover more about diseases related to LYPLAL1 Antibody (NBP2-85246).
 

Pathways for LYPLAL1 Antibody (NBP2-85246)

View related products by pathway.

PTMs for LYPLAL1 Antibody (NBP2-85246)

Learn more about PTMs related to LYPLAL1 Antibody (NBP2-85246).
 

Research Areas for LYPLAL1 Antibody (NBP2-85246)

Find related products by research area.

Blogs on LYPLAL1

There are no specific blogs for LYPLAL1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LYPLAL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LYPLAL1