![Western Blot: LYPLAL1 Antibody [NBP2-85246] - WB Suggested Anti-LYPLAL1 Antibody. Titration: 1.0 ug/ml. Positive Control: COLO205 Whole Cell](http://images.novusbio.com/fullsize2/LYPLAL1-Antibody-Western-Blot-NBP2-85246-img0001.jpg "Western Blot: LYPLAL1 Antibody [NBP2-85246] - WB Suggested Anti-LYPLAL1 Antibody. Titration: 1.0 ug/ml. Positive Control: COLO205 Whole Cell")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human LYPLAL1. Peptide sequence: MCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFA The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LYPLAL1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry/Immunofluorescence: PLA2G4A Antibody [NBP1-31344] - Analysis of HeLa, using NBP1-31344 at 1:200 dilution.](http://images.novusbio.com/images2/PLA2G4A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-31344-img0008.jpg)
![Immunohistochemistry-Paraffin: PLA2G4A Antibody [NBP1-31344] - U87 xenograft, using PLA2G4A antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.](http://images.novusbio.com/images2/PLA2G4A-Antibody-Immunohistochemistry-Paraffin-NBP1-31344-img0009.jpg)
![Western Blot: PLA2G4A Antibody [NBP1-31344] - Sample (30 ug of whole cell lysate) A: NIH-3T3 7.5% SDS PAGE; antibody diluted at 1:1000.](http://images.novusbio.com/images2/PLA2G4A-Antibody-Western-Blot-NBP1-31344-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: Kilon/NEGR1 Antibody [NBP1-83116] - Staining of human cell line U-2 OS shows localization to actin filaments. Antibody staining is shown in green.](http://images.novusbio.com/images2/Kilon-NEGR1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83116-img0007.jpg)
![Immunohistochemistry-Paraffin: Kilon/NEGR1 Antibody [NBP1-83116] - Staining of human cerebellum shows weak to moderate cytoplasmic positivity in cells in molecular layer.](http://images.novusbio.com/images2/Kilon-NEGR1-Antibody-Immunohistochemistry-Paraffin-NBP1-83116-img0008.jpg)
![Immunohistochemistry-Paraffin: Kilon/NEGR1 Antibody [NBP1-83116] - Staining of human cerebral cortex shows moderate positivity in neuropil.](http://images.novusbio.com/images2/Kilon-NEGR1-Antibody-Immunohistochemistry-Paraffin-NBP1-83116-img0009.jpg)
![Western Blot: LYPLA1 Antibody (JE47-60) [NBP2-80466] - Analysis of Lysophospholipase 1 on mouse stomach tissue lysate. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody at 1:500 was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature.](http://images.novusbio.com/images2/LYPLA1-Antibody-(JE47-60)-Western-Blot-NBP2-80466-img0001.jpg)
![Immunohistochemistry-Paraffin: LYPLA1 Antibody (JE47-60) [NBP2-80466] - Immunohistochemical analysis of paraffin-embedded rat kidney tissue using anti-Lysophospholipase 1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody at 1:200 for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.](http://images.novusbio.com/images2/LYPLA1-Antibody-(JE47-60)-Immunohistochemistry-Paraffin-NBP2-80466-img0003.jpg)
![Immunohistochemistry-Paraffin: LYPLA1 Antibody (JE47-60) [NBP2-80466] - Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue using anti-Lysophospholipase 1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody at 1:200 for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.](http://images.novusbio.com/images2/LYPLA1-Antibody-(JE47-60)-Immunohistochemistry-Paraffin-NBP2-80466-img0004.jpg)
![Immunofluorescence: MTCH2 Antibody [NBP1-76998] - Mouse Kidney cells with MTCH2 antibody at 20 ug/mL.](http://images.novusbio.com/images2/MTCH2-Antibody-Immunofluorescence-NBP1-76998-img0003.jpg)
![Western Blot: MTCH2 Antibody [NBP1-76998] - 293 cell lysate with MTCH2 antibody at 1 ug/mL.](http://images.novusbio.com/images2/MTCH2-Antibody-Western-Blot-NBP1-76998-img0001.jpg)
![Immunohistochemistry-Paraffin: MTCH2 Antibody [NBP1-76998] - Mouse kidney tissue with MTCH2 antibody at 5 ug/ml.](http://images.novusbio.com/images2/MTCH2-Antibody-Immunohistochemistry-Paraffin-NBP1-76998-img0002.jpg)
![Western Blot: TMEM18 Antibody [NBP2-81843] - Western blot analysis of TMEM18 in rat brain lysate with TMEM18 antibody at (A) 0.5 and (B) 1 ug/mL.](http://images.novusbio.com/images2/TMEM18-Antibody-Western-Blot-NBP2-81843-img0001.jpg)
![Immunohistochemistry: TMEM18 Antibody [NBP2-81843] - Immunohistochemistry of TMEM18 in mouse brain tissue with TMEM18 antibody at 2.5 ug/mL.](http://images.novusbio.com/images2/TMEM18-Antibody-Immunohistochemistry-NBP2-81843-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: TMEM18 Antibody [NBP2-81843] - Immunofluorescence of TMEM18 in Mouse Brain cells with TMEM18 antibody at 20 ug/mL.](http://images.novusbio.com/images2/TMEM18-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-81843-img0003.jpg)
![Immunofluorescence: Melanocortin-4 R Antibody [NBP2-41103] - Human Brain cells with MC4R antibody at 20 ug/mL.](http://images.novusbio.com/images2/Melanocortin-4-R-Antibody-Immunofluorescence-NBP2-41103-img0003.jpg)
![Immunohistochemistry-Paraffin: Melanocortin-4 R Antibody [NBP2-41103] - human brain tissue with MC4R antibody at 2.5 ug/mL.](http://images.novusbio.com/images2/Melanocortin-4-R-Antibody-Immunohistochemistry-Paraffin-NBP2-41103-img0002.jpg)
![Western Blot: Melanocortin-4 R Antibody [NBP2-41103] - Western blot analysis of MC4R in rat brain tissue lysate with MC4R antibody at 1 ug/mL in (A) the absence and (B) the presence of blocking peptide.](http://images.novusbio.com/images2/Melanocortin-4-R-Antibody-Western-Blot-NBP2-41103-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: GNPDA2 Antibody [NBP1-76997] - Immunofluorescence of GNPDA2 in mouse kidney tissue with GNPDA2 antibody at 20 ug/mL.](http://images.novusbio.com/images2/GNPDA2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-76997-img0003.jpg)
![Western Blot: GNPDA2 Antibody [NBP1-76997] - Human kidney lysate with GNPDA2 antibody at 1 ug/mL.](http://images.novusbio.com/images2/GNPDA2-Antibody-Western-Blot-NBP1-76997-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: GNPDA2 Antibody [NBP1-76997] - 293 cells with GNPDA2 antibody at 4 ug/ml.](http://images.novusbio.com/images2/GNPDA2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-76997-img0002.jpg)
![Western Blot: LZTR2 Antibody [NBP1-77122] - WB Validation in 293 Cells. Loading: 10 ug of cell lysate. Antibodies: LZTR2 5623-1001, 0.5 ug/mL, 1 h incubation at RT in 5% NFDM/TBST. Secondary: Goat Anti-Rabbit IgG HRP conjugate at 1:10000 dilution. Exposure: 10 sec. Lane 1: In the absence of peptide blocking. Lane 2: In the presence of peptide blocking.](http://images.novusbio.com/images2/LZTR2-Antibody-Western-Blot-NBP1-77122-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: LZTR2 Antibody [NBP1-77122] - Mouse kidney tissue](http://images.novusbio.com/images2/LZTR2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-77122-img0003.jpg)
![Immunohistochemistry-Paraffin: LZTR2 Antibody [NBP1-77122] - Mouse kidney tissue with LZTR2 antibody at 5 ug/mL.](http://images.novusbio.com/images2/LZTR2-Antibody-Immunohistochemistry-Paraffin-NBP1-77122-img0002.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for LYPLAL1 Antibody (NBP2-85246)Discover more about diseases related to LYPLAL1 Antibody (NBP2-85246).
| Pathways for LYPLAL1 Antibody (NBP2-85246)View related products by pathway.
|
PTMs for LYPLAL1 Antibody (NBP2-85246)Learn more about PTMs related to LYPLAL1 Antibody (NBP2-85246).
| Research Areas for LYPLAL1 Antibody (NBP2-85246)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LYPLAL1 |
![Western Blot: Methionine Sulfoxide Reductase A Antibody [NBP1-87456] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/images2/Methionine-Sulfoxide-Reductase-A-Antibody-Western-Blot-NBP1-87456-img0004.jpg)
![Immunohistochemistry-Paraffin: Methionine Sulfoxide Reductase A Antibody [NBP1-87456] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/images2/Methionine-Sulfoxide-Reductase-A-Antibody-Immunohistochemistry-Paraffin-NBP1-87456-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Methionine Sulfoxide Reductase A Antibody [NBP1-87456] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & actin filaments.](http://images.novusbio.com/images2/Methionine-Sulfoxide-Reductase-A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87456-img0006.jpg)
![Western Blot: Phospholipase B1 Antibody [H00151056-B01P] - Analysis of PLB1 expression in transfected 293T cell line by PLB1 polyclonal antibody. Lane 1: PLB1 transfected lysate(46.53 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/Phospholipase-B1-Antibody-Western-Blot-H00151056-B01P-img0001.jpg)
![Western Blot: FTO Antibody [NB110-60935] - Detection of FTO in human brain lysate using anti-FTO NB110-60935.](http://images.novusbio.com/images2/FTO-Antibody-Western-Blot-NB110-60935-img0003.jpg)
![Western Blot: HDAC9 Antibody [NBP2-03993] - Analysis of HDAC-9 in human HeLa cell lysate in the 1) absence and 2) presence of immunizing peptide and 3) and mouse RAW cell lysate using this antibody. 0 ug/ml, 1.0 ug/ml and 0.5 ug/ml respectively. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.](http://images.novusbio.com/images2/HDAC9-Antibody-Western-Blot-NBP2-03993-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: KCTD15 Antibody [H00079047-B01P] - Analysis of purified antibody to KCTD15 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/images2/KCTD15-Antibody-Immunocytochemistry-Immunofluorescence-H00079047-B01P-img0004.jpg)
![Western Blot: KCTD15 Antibody [H00079047-B01P] - Analysis of KCTD15 expression in transfected 293T cell line by KCTD15 polyclonal antibody. Lane 1: KCTD15 transfected lysate(25.74 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/KCTD15-Antibody-Western-Blot-H00079047-B01P-img0006.jpg)
![Western Blot: KCTD15 Antibody [H00079047-B01P] - Analysis of KCTD15 expression in rat brain.](http://images.novusbio.com/images2/KCTD15-Antibody-Western-Blot-H00079047-B01P-img0005.jpg)
![Flow Cytometry: TAP1 Antibody (3D4) [H00006890-M04] - Intracellular flow cytometric analysis of TAP1 antibody H00006890-M04 (orange filled) on interferon gamma treated HCT116 cells. Red dotted line in histogram represents unstained and blue filled line represents isotype control. Flow cytometry image added from a verified customer review.](http://images.novusbio.com/images2/TAP1-Antibody-(3D4)-Flow-Cytometry-H00006890-M04-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: TAP1 Antibody (3D4) [H00006890-M04] - Analysis of monoclonal antibody to TAP1 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/images2/TAP1-Antibody-(3D4)-Immunocytochemistry-Immunofluorescence-H00006890-M04-img0001.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
