Ly-6D Antibody - BSA Free

Immunohistochemistry-Paraffin: Ly-6D Antibody [NBP2-49416] - Analysis in human skin and kidney tissues using antibody. Corresponding LY6D RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Ly-6D Antibody [NBP2-49416] - Staining of human cervix, uterine, kidney, liver and skin using Anti-LY6D antibody NBP2-49416 (A) shows similar protein distribution across tissues to independent antibody NBP1-84029 (B).

Western Blot: Ly-6D Antibody [NBP2-49416] - Analysis in control (vector only transfected HEK293T lysate) and LY6D over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: Ly-6D Antibody [NBP2-49416] - Staining of human cervix shows moderate membranous positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: Ly-6D Antibody [NBP2-49416] - Staining of human kidney shows no positivity in cells in tubules as expected.

Immunohistochemistry-Paraffin: Ly-6D Antibody [NBP2-49416] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Ly-6D Antibody [NBP2-49416] - Staining of human skin shows strong membranous positivity in squamous epithelial cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Ly-6D Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Ly-6D Antibody - BSA Free (NBP2-49416) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LY6D
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Ly-6D Recombinant Protein Antigen (NBP2-49416PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Ly-6D Antibody - BSA Free

• E48E48 antigen
• Ly-6D
• lymphocyte antigen 6 complex, locus D
• lymphocyte antigen 6D

Background

Ly-6D may act as a specification marker at earliest stage specification of lymphocytes between B- and T-cell development. Marks the earliest stage of B-cell specification

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LY6D