POU2F3 Antibody

Immunohistochemistry-Paraffin: POU2F3 Antibody [NBP1-83966] - Analysis in human skin and skeletal muscle tissues. Corresponding RNA-seq data are presented for the same tissues

Western Blot: POU2F3 Antibody [NBP1-83966] - Analysis in control (vector only transfected HEK293T lysate) and POU2F3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Frozen: POU2F3 Antibody [NBP1-83966] - Analysis of human airway cell line using POU2F3 antibody. Nuclear staining with DAPI. Image overlap in right panel. IHC-Fr image submitted by a verified customer review.

Immunohistochemistry-Paraffin: POU2F3 Antibody [NBP1-83966] - Staining of human skin shows moderate to strong nuclear positivity in keratinocytes.

Immunohistochemistry-Paraffin: POU2F3 Antibody [NBP1-83966] - Staining of human skeletal muscle shows no positivity in myocytes

Immunohistochemistry-Paraffin: POU2F3 Antibody [NBP1-83966] - Staining of human kidney shows no positivity in cells in tubules.

Immunohistochemistry-Paraffin: POU2F3 Antibody [NBP1-83966] - Staining of human pancreas shows no positivity in exocrine glandular cells.

• Reactivity: Hu
• Applications: WB, IHC, IHC-Fr, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

POU2F3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POU2F3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. POU2F3 antibody validated for IHC-Fr from a verified customer review.
• Control Peptide:

  POU2F3 Protein (NBP1-83966PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for POU2F3 Antibody

• Epoc-1
• MGC126698
• oct-11
• OCT11FLJ40063
• Octamer-binding protein 11
• Octamer-binding transcription factor 11
• OTF11
• OTF-11
• PLA1
• PLA-1
• POU class 2 homeobox 3
• POU domain class 2, transcription factor 3
• POU domain, class 2, transcription factor 3
• POU transcription factor
• Skn-1a
• Transcription factor PLA-1
• Transcription factor Skn-1

Background

POU2F3, also referred to as POU domain, class 2, transcription factor 3, is a transcription factor that belongs to the POU protein family. POU2F3 has a 436 amino acid long isoform, a 438 amino acid long isoform, and a 432 amino acid long isoform, all three of which are approximately 47kDa. POU2F3 is highly expressed in keratinocytes and the epidermis. Current research surrounding POU2F3 has shown possible interactions with diseases and disorders such as atherosclerosis, bipolar disorder, herpes, cervical cancer, breast cancer, and neuroendocrine tumors. POU2F3 has also been shown to interact with Bcl6, Ubiquitin and KAT3A/CBP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for POU2F3 Antibody (NBP1-83966)(2)

Publications using NBP1-83966

• Cai L, Liu H, Huang F et al. Cell-autonomous immune gene expression is repressed in pulmonary neuroendocrine cells and small cell lung cancer Communications biology 2021-03-09 [PMID: 33750914] (IHC)
• Gay CM, Stewart CA, Park EM, et al. Patterns of transcription factor programs and immune pathway activation define four major subtypes of SCLC with distinct therapeutic vulnerabilities Cancer cell 2021-01-05 [PMID: 33482121]

Review for POU2F3 Antibody (NBP1-83966) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer IHC-Fr Human 08/23/2019

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: cell line,human airway
• Species: Human
• Lot: A116344

Bioinformatics

• Gene Symbol: POU2F3