POU2F3 Antibody - BSA Free

Immunohistochemistry-Paraffin: POU2F3 Antibody [NBP1-83966] - Analysis in human skin and skeletal muscle tissues. Corresponding RNA-seq data are presented for the same tissues

Immunohistochemistry-Frozen: POU2F3 Antibody [NBP1-83966] - Analysis of human airway cell line using POU2F3 antibody. Nuclear staining with DAPI. Image overlap in right panel. IHC-Fr image submitted by a verified customer review.

Immunohistochemistry-Paraffin: POU2F3 Antibody [NBP1-83966] - Staining of human skin shows moderate to strong nuclear positivity in keratinocytes.

Immunohistochemistry-Paraffin: POU2F3 Antibody [NBP1-83966] - Staining of human skeletal muscle shows no positivity in myocytes

Immunohistochemistry-Paraffin: POU2F3 Antibody [NBP1-83966] - Staining of human kidney shows no positivity in cells in tubules.

Immunohistochemistry-Paraffin: POU2F3 Antibody [NBP1-83966] - Staining of human pancreas shows no positivity in exocrine glandular cells.

Analysis in control (vector only transfected HEK293T lysate) and POU2F3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

POU2F3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit POU2F3 Antibody - BSA Free (NBP1-83966) is a polyclonal antibody validated for use in IHC and WB. Anti-POU2F3 Antibody: Cited in 8 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POU2F3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen -Validated from a verified customer review.
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  POU2F3 Protein (NBP1-83966PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for POU2F3 Antibody - BSA Free

• Epoc-1
• MGC126698
• OCT11
• OCT-11
• OCT11FLJ40063
• Octamer-binding protein 11
• Octamer-binding transcription factor 11
• OTF11
• OTF-11
• PLA1
• PLA-1
• POU class 2 homeobox 3
• POU domain class 2, transcription factor 3
• POU domain, class 2, transcription factor 3
• POU transcription factor
• POU2F3
• Skn-1a
• Transcription factor PLA-1
• Transcription factor Skn-1

Background

POU2F3, also referred to as POU domain, class 2, transcription factor 3, is a transcription factor that belongs to the POU protein family. POU2F3 has a 436 amino acid long isoform, a 438 amino acid long isoform, and a 432 amino acid long isoform, all three of which are approximately 47kDa. POU2F3 is highly expressed in keratinocytes and the epidermis. Current research surrounding POU2F3 has shown possible interactions with diseases and disorders such as atherosclerosis, bipolar disorder, herpes, cervical cancer, breast cancer, and neuroendocrine tumors. POU2F3 has also been shown to interact with Bcl6, Ubiquitin and KAT3A/CBP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for POU2F3 Antibody (NBP1-83966)(8)

Publications using NBP1-83966

• Wang Z, Liu C, Zheng S, Yao Y et Al. Molecular subtypes of neuroendocrine carcinomas: A cross-tissue classification framework based on five transcriptional regulators Cancer Cell 2024-05-24 [PMID: 38788718]
• Park S, Hong TH, Hwang S, Heeke S et Al. Comprehensive analysis of transcription factor-based molecular subtypes and their correlation to clinical outcomes in small-cell lung cancer EBioMedicine 2024-03-16 [PMID: 38492534]
• Kim J, Kim S, Park SY et al. Molecular Subtypes and Tumor Microenvironment Characteristics of Small-Cell Lung Cancer Associated with Platinum-Resistance Cancers (Basel) 2023-07-11 [PMID: 37509231]
• Hwang S, Hong TH, Kim HK et al. Whole-Section Landscape Analysis of Molecular Subtypes in Curatively Resected Small Cell Lung Cancer: Clinicopathologic Features and Prognostic Significance Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2023-04-11 [PMID: 37054974] (IHC, Human)
• Tian Y, Li Q, Yang Z et al. Single-cell transcriptomic profiling reveals the tumor heterogeneity of small-cell lung cancer Signal Transduction and Targeted Therapy 2022-10-05 [PMID: 36195615]
• Hwang S, Hong TH, Park S et al. Molecular subtypes of small cell lung cancer transformed from adenocarcinoma after EGFR tyrosine kinase inhibitor treatment Translational Lung Cancer Research 2021-12-01 [PMID: 35004251]
• Cai L, Liu H, Huang F et al. Cell-autonomous immune gene expression is repressed in pulmonary neuroendocrine cells and small cell lung cancer Communications biology 2021-03-09 [PMID: 33750914] (IF/IHC)
• Gay CM, Stewart CA, Park EM, et al. Patterns of transcription factor programs and immune pathway activation define four major subtypes of SCLC with distinct therapeutic vulnerabilities Cancer cell 2021-01-05 [PMID: 33482121]

Review for POU2F3 Antibody (NBP1-83966) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: avinash waghray IHC-Fr Human 08/23/2019

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: cell line,human airway
• Species: Human
• Lot: A116344

Bioinformatics

• Gene Symbol: POU2F3