POU2F3 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: POU2F3 Antibody [NBP1-83966] - Analysis in human skin and skeletal muscle tissues. Corresponding RNA-seq data are presented for the same tissues
Western Blot: POU2F3 Antibody [NBP1-83966] - Analysis in control (vector only transfected HEK293T lysate) and POU2F3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Frozen: POU2F3 Antibody [NBP1-83966] - Analysis of human airway cell line using POU2F3 antibody. Nuclear staining with DAPI. Image overlap in right panel. IHC-Fr image submitted by a verified ...read more
Immunohistochemistry-Paraffin: POU2F3 Antibody [NBP1-83966] - Staining of human skin shows moderate to strong nuclear positivity in keratinocytes.
Immunohistochemistry-Paraffin: POU2F3 Antibody [NBP1-83966] - Staining of human skeletal muscle shows no positivity in myocytes
Immunohistochemistry-Paraffin: POU2F3 Antibody [NBP1-83966] - Staining of human kidney shows no positivity in cells in tubules.
Immunohistochemistry-Paraffin: POU2F3 Antibody [NBP1-83966] - Staining of human pancreas shows no positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

POU2F3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQP
Specificity
Specificity of human POU2F3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POU2F3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. POU2F3 antibody validated for IHC-Fr from a verified customer review.
Control Peptide
POU2F3 Protein (NBP1-83966PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-83966 in the following applications:

Publications
Read Publication using NBP1-83966.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for POU2F3 Antibody

  • Epoc-1
  • MGC126698
  • oct-11
  • OCT11FLJ40063
  • Octamer-binding protein 11
  • Octamer-binding transcription factor 11
  • OTF11
  • OTF-11
  • PLA1
  • PLA-1
  • POU class 2 homeobox 3
  • POU domain class 2, transcription factor 3
  • POU domain, class 2, transcription factor 3
  • POU transcription factor
  • Skn-1a
  • Transcription factor PLA-1
  • Transcription factor Skn-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32569
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42399
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-46431
Species: Hu, Mu, Rt
Applications: WB
H00151056-B01P
Species: Hu, Mu
Applications: WB
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP3-04883
Species: Hu, Mu, Rt
Applications: WB
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-31344
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75734
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PA
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-84579
Species: Hu
Applications: IHC, IHC-P
NBP2-32962
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-17311
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, KD
NBP2-73857
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-83966
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for POU2F3 Antibody (NBP1-83966)(1)

Review for POU2F3 Antibody (NBP1-83966) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-83966:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen POU2F3 NBP1-83966
Enlarge
5
reviewed by:
avinash waghray
IHC-Fr Human 08/23/2019
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample Testedhuman airway, cell line
SpeciesHuman
LotA116344

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POU2F3 Antibody (NBP1-83966) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional POU2F3 Products

Bioinformatics Tool for POU2F3 Antibody (NBP1-83966)

Discover related pathways, diseases and genes to POU2F3 Antibody (NBP1-83966). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POU2F3 Antibody (NBP1-83966)

Discover more about diseases related to POU2F3 Antibody (NBP1-83966).
 

Pathways for POU2F3 Antibody (NBP1-83966)

View related products by pathway.

PTMs for POU2F3 Antibody (NBP1-83966)

Learn more about PTMs related to POU2F3 Antibody (NBP1-83966).

Blogs on POU2F3

There are no specific blogs for POU2F3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

avinash waghray
08/23/2019
Application: IHC-Fr
Species: Human

Bioinformatics

Gene Symbol POU2F3