LSP1 Antibody (4U10N5)

Western Blot: LSP1 Antibody (4U10N5) [NBP3-16171] - Western blot analysis of various lysates, using LSP1 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 60s.

Immunocytochemistry/ Immunofluorescence: LSP1 Antibody (4U10N5) [NBP3-16171] - Immunofluorescence analysis of Jurkat cells using LSP1 Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: LSP1 Antibody (4U10N5) [NBP3-16171] - Immunofluorescence analysis of rat spleen using LSP1 Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: LSP1 Antibody (4U10N5) [NBP3-16171] - Immunofluorescence analysis of mouse spleen using LSP1 Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 4U10N5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

LSP1 Antibody (4U10N5) Summary

• Description: Novus Biologicals Rabbit LSP1 Antibody (4U10N5) (NBP3-16171) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 240-339 of human LSP1 (P33241). TAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: LSP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LSP1 Antibody (4U10N5)

• 47 kDa actin binding protein
• 47 kDa actin-binding protein
• 52 kDa phosphoprotein
• F-actin binding and cytoskeleton associated protein
• leufactin (leukocyte F-actin binding protein)
• leukocyte-specific protein 1
• lymphocyte-specific protein 1
• lymphocyte-specific protein pp52
• pp52
• WP34Lymphocyte-specific antigen WP34

Background

LSP1 encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LSP1