LSM6 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: LSM6 Antibody [NBP1-92083] - Immunofluorescent staining of human cell line U-2 OS shows localization to actin filaments.

Immunohistochemistry-Paraffin: LSM6 Antibody [NBP1-92083] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LSM6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LSM6 Antibody - BSA Free (NBP1-92083) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LSM6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LSM6 Protein (NBP1-92083PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LSM6 Antibody - BSA Free

• LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae)
• Sm protein F
• U6 snRNA-associated Sm-like protein LSm6
• YDR378C

Background

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (seeSNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linkerof variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present intri-snRNP particles, which are important for pre-mRNA splicing.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LSM6