LSM3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: LSM3 Antibody [NBP2-14206] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: LSM3 Antibody [NBP2-14206] - Staining of human testis shows strong nuclear positivity in subset of cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LSM3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: DDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDG
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LSM3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LSM3 Protein (NBP2-14206PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LSM3 Antibody - BSA Free

• LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae)
• SMX4
• U6 snRNA-associated Sm-like protein LSm3
• USS2
• YLR438C

Background

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LSM3 Antibody (NBP2-14206)(1)

Publication using NBP2-14206

• Autour A, C Y Jeng S, D Cawte A, Abdolahzadeh A. Fluorogenic RNA Mango aptamers for imaging small non-coding RNAs in mammalian cells. Nat Commun. 2018-02-13 [PMID: 29440634] (IF/IHC)

Bioinformatics

• Gene Symbol: LSM3