LRRFIP1 Antibody - BSA Free

Western Blot: LRRFIP1 Antibody [NBP2-87744] - Host: Rabbit. Target Name: Lrrfip1. Sample Type: Mouse Muscle lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

LRRFIP1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse LRRFIP1. Peptide sequence: IREIKELNELKDQIQDVEGKYMQGLKEMKDSLAEVEEKYKKAMVSNAQLD The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LRRFIP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for LRRFIP1 Antibody - BSA Free

• FLAP-1
• FLIIAP1
• GC-binding factor 2
• GCF2
• GCF-2
• HUFI-1
• leucine rich repeat (in FLII) interacting protein 1
• leucine-rich repeat flightless-interacting protein 1
• LRR FLII-interacting protein 1
• MGC10947
• MGC119738
• MGC119739
• NEDD8-conjugating enzyme
• TRIPTAR RNA-interacting protein

Background

Transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA. May control smooth muscle cells proliferation following artery injury through PDGFA repression. May also bind double-stranded RNA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LRRFIP1