![Western Blot: LRRC6 Antibody [NBP1-82816] - Analysis in human cell line U-2 OS.](http://images.novusbio.com/fullsize/LRRC6-Antibody-Western-Blot-NBP1-82816-img0008.jpg "Western Blot: LRRC6 Antibody [NBP1-82816] - Analysis in human cell line U-2 OS.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit LRRC6 Antibody - BSA Free (NBP1-82816) is a polyclonal antibody validated for use in IHC and WB. Anti-LRRC6 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TTGHLVICMPKVGEVITGGQRAFKSMKTTSDRSREQTNTRSKHMEKLEVDPSKHSFPDVTNIVQEKKHTPRRRPEPKIIPSE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DNAAF11 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Simple_Western_17480.jpg)
![Western Blot CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Western_Blot_18637.jpg)
![Immunohistochemistry CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/SCF_R_AF1356_Immunohistochemistry_9746.jpg)
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
| Publication using NBP1-82816 | Applications | Species |
|---|---|---|
| Horani A, Ferkol TW, Shoseyov D et al. LRRC6 Mutation Causes Primary Ciliary Dyskinesia with Dynein Arm Defects. PLoS One 2013-01-01 [PMID: 23527195] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DNAAF11 |
![Immunohistochemistry-Paraffin: LRRC6 Antibody [NBP1-82816] - Staining of human fallopian tube shows strong cytoplasmic positivity in a subset of glandular cells.](http://images.novusbio.com/fullsize/LRRC6-Antibody-Immunohistochemistry-Paraffin-NBP1-82816-img0006.jpg "Immunohistochemistry-Paraffin: LRRC6 Antibody [NBP1-82816] - Staining of human fallopian tube shows strong cytoplasmic positivity in a subset of glandular cells.")
![Western Blot SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Western_Blot_20730.jpg)
![Immunohistochemistry SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Immunohistochemistry_10419.jpg)
![Immunocytochemistry SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Immunocytochemistry__Immunofluorescence_23321.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Immunocytochemistry CRIPTO Antibody [Unconjugated]](https://images.novusbio.com/images2/Cripto_AF1538_Immunocytochemistry__Immunofluorescence_20121.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")