LRRC50 Antibody


Immunohistochemistry-Paraffin: LRRC50 Antibody [NBP2-62685] - Staining of human testis shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: LRRC50 Antibody [NBP2-62685] - Analysis in human testis and prostate tissues using Anti-DNAAF1 antibody. Corresponding DNAAF1 RNA-seq data are presented for more
Immunohistochemistry-Paraffin: LRRC50 Antibody [NBP2-62685] - Staining of human prostate shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

LRRC50 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SLEDQNMCFPKIEVISSLSDDSDPELDYTSLPVLENLPTDTLSNIFAVSKDTSKAARVPFTDIFK
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Protein A purified

Alternate Names for LRRC50 Antibody

  • CILD13
  • DKFZp434A119
  • FLJ25330
  • leucine rich repeat containing 50
  • ODA7leucine-rich repeat-containing protein 50
  • outer row dynein assembly 7 homolog


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for LRRC50 Antibody (NBP2-62685) (0)

There are no publications for LRRC50 Antibody (NBP2-62685).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC50 Antibody (NBP2-62685) (0)

There are no reviews for LRRC50 Antibody (NBP2-62685). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LRRC50 Antibody (NBP2-62685) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional LRRC50 Products

Bioinformatics Tool for LRRC50 Antibody (NBP2-62685)

Discover related pathways, diseases and genes to LRRC50 Antibody (NBP2-62685). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRC50 Antibody (NBP2-62685)

Discover more about diseases related to LRRC50 Antibody (NBP2-62685).

Pathways for LRRC50 Antibody (NBP2-62685)

View related products by pathway.

Blogs on LRRC50

There are no specific blogs for LRRC50, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LRRC50 Antibody and receive a gift card or discount.


Gene Symbol DNAAF1
COVID-19 update