LRRC6 Antibody

Images

 
Western Blot: LRRC6 Antibody [NBP1-53157] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRRC6 Antibody Summary

Immunogen
Synthetic peptides corresponding to LRRC6(leucine rich repeat containing 6) The peptide sequence was selected from the middle region of LRRC6. Peptide sequence MKTTSDRSREQTNTRSKHMEKLEVDPSKHSFPDVTNIVQEKKHTPRRRPE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRRC6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LRRC6 and was validated on Western blot.
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LRRC6 Antibody

  • leucine rich repeat containing 6
  • Leucine-rich testis-specific protein
  • LRTPleucine-rich repeat-containing protein 6
  • Testis-specific leucine-rich repeat protein
  • TSLRPtestis specific leucine rich repeat protein

Background

LRRC6 may be involved in spermatocytogenesis or prophase of meiosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
H00058524-R01
Species: Hu
NBP2-19614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1199
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-28872
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90195
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15412
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-01936
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-53157
Species: Hu
Applications: WB

Publications for LRRC6 Antibody (NBP1-53157) (0)

There are no publications for LRRC6 Antibody (NBP1-53157).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC6 Antibody (NBP1-53157) (0)

There are no reviews for LRRC6 Antibody (NBP1-53157). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRRC6 Antibody (NBP1-53157) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRRC6 Products

Bioinformatics Tool for LRRC6 Antibody (NBP1-53157)

Discover related pathways, diseases and genes to LRRC6 Antibody (NBP1-53157). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRC6 Antibody (NBP1-53157)

Discover more about diseases related to LRRC6 Antibody (NBP1-53157).
 

Pathways for LRRC6 Antibody (NBP1-53157)

View related products by pathway.

Blogs on LRRC6

There are no specific blogs for LRRC6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRRC6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRC6
Uniprot