LRP-5 Recombinant Protein Antigen

Images

 
There are currently no images for LRP-5 Protein (NBP2-37868PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LRP-5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LRP5.

Source: E. coli

Amino Acid Sequence: VVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPATARPYRPYII

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LRP5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-37868.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LRP-5 Recombinant Protein Antigen

  • BMND1
  • BMND1OPTA1
  • EVR1
  • EVR4
  • HBM
  • low density lipoprotein receptor-related protein 5
  • low density lipoprotein receptor-related protein 7
  • low-density lipoprotein receptor-related protein 5
  • LR3VBCH2
  • LRP5
  • LRP-5
  • LRP7
  • LRP7exudative vitreoretinopathy 1
  • OPPG
  • OPS
  • OPTA1
  • osteoporosis pseudoglioma syndrome
  • VBCH2

Background

LRP5 is involved in the Wnt/beta catenin signaling pathway, probably by acting as a coreceptor together with Frizzled for Wnt. Defects in LRP5 are a cause of autosomal dominant and autosomal recessive familial exudative vitreoretinopathy (FEVR). Autosomal dominant FEVR is also referred to as exudative vitreoretinopathy 1 (EVR1); also known as Criswick-Schepens syndrome. FEVR is a disorder of the retinal vasculature characterized by an abrupt cessation of growth of peripheral capillaries, leading to an avascular peripheral retina. This may lead to compensatory retinal neovascularization, which is thought to be induced by hypoxia from the initial avascular insult. New vessels are prone to leakage and rupture causing exudates and bleeding, followed by scarring, retinal detachment and blindness. FEVR is reported to have a penetrance of 100%, but clinical features can be highly variable, even within the same family. Patients with mild forms of the disease are asymptomatic, and their only disease-related abnormality is an arc of avascular retina in the extreme temporal periphery.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1505
Species: Hu
Applications: CyTOF-ready, Flow, ICC
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP1-89953
Species: Hu, Mu
Applications: IHC,  IHC-P
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, PLA, WB
5439-DK
Species: Hu
Applications: BA
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
DY805
Species: Hu
Applications: ELISA
5036-WN
Species: Hu
Applications: BA, BA
NB100-64808
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
AF3287
Species: Hu, Mu, Rt
Applications: WB
AF3014
Species: Hu
Applications: Block, IHC, WB
NBP1-82820
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP3-14454
Species: Hu
Applications: IHC,  IHC-P
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA, WB
AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
NBP2-46367
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1120
Species: Mu
Applications: IHC, WB
MAB7665
Species: Hu
Applications: IHC, WB
NBP2-37868PEP
Species: Hu
Applications: AC

Publications for LRP-5 Protein (NBP2-37868PEP) (0)

There are no publications for LRP-5 Protein (NBP2-37868PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRP-5 Protein (NBP2-37868PEP) (0)

There are no reviews for LRP-5 Protein (NBP2-37868PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LRP-5 Protein (NBP2-37868PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LRP-5 Products

Research Areas for LRP-5 Protein (NBP2-37868PEP)

Find related products by research area.

Blogs on LRP-5

There are no specific blogs for LRP-5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LRP-5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LRP5