LRIG2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LRIG2 Antibody [NBP1-93621] - Staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LRIG2 Antibody [NBP1-93621] - Staining of human epididymis shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRIG2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IPSYLSSQGTLSEPQEGYSNSEAGSHQQLMPPANGYIHKGTDGGTGTRVICSDCYDNANIYSRTREYCPYTYIAEEDVLDQTLSSLMVQMPKETYLVHPPQDTTALESLIPSANREPSAFPTNHERISEKKLPSTQMSGETLQRPVWNINRELGLPHPPFSQQPVHESPQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRIG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LRIG2 Protein (NBP1-93621PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRIG2 Antibody

  • KIAA0806
  • leucine-rich repeats and immunoglobulin-like domains 2
  • leucine-rich repeats and immunoglobulin-like domains protein 2
  • LIG2
  • LRIG2
  • UFS2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3688
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
AF3495
Species: Hu
Applications: IHC, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
236-EG
Species: Hu
Applications: BA
NB100-119
Species: Ba, Ch, Fi, Ha, Hu, Mu, Rb
Applications: ICC/IF, IHC-P, IP, In vitro, RIA, WB
AF644
Species: Mu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
DY417
Species: Mu
Applications: ELISA
MAB3481
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, Neut
NBP1-77847
Species: Hu, Mu
Applications: ChIP, ELISA, IHC, IHC-P, IP, WB
1129-ER
Species: Hu
Applications: BA
NBP1-33120
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-20932
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-48909
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO
NBP2-24763
Species: Hu, Pm
Applications: IHC, IHC-P, WB

Publications for LRIG2 Antibody (NBP1-93621) (0)

There are no publications for LRIG2 Antibody (NBP1-93621).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRIG2 Antibody (NBP1-93621) (0)

There are no reviews for LRIG2 Antibody (NBP1-93621). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LRIG2 Antibody (NBP1-93621) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRIG2 Products

Array NBP1-93621

Bioinformatics Tool for LRIG2 Antibody (NBP1-93621)

Discover related pathways, diseases and genes to LRIG2 Antibody (NBP1-93621). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRIG2 Antibody (NBP1-93621)

Discover more about diseases related to LRIG2 Antibody (NBP1-93621).
 

Pathways for LRIG2 Antibody (NBP1-93621)

View related products by pathway.

PTMs for LRIG2 Antibody (NBP1-93621)

Learn more about PTMs related to LRIG2 Antibody (NBP1-93621).

Blogs on LRIG2

There are no specific blogs for LRIG2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRIG2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRIG2