LRBA Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LRBA Antibody [NBP1-90765] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: LRBA Antibody [NBP1-90765] - Staining of human kidney shows cytoplasmic positivity in cells in tubules and glomeruli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRBA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SVLMVSKYRDILEPQNERHSQSCTETGSENENVSLSEITPAAFSTLTTASVEESESTSSARRRDSGIGEETATGLGSHVEVTPHTAPPGVSAGPDAISEVLSTLSLEVNKSPETKNDRGNDLDTKATPSVSV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRBA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LRBA Protein (NBP1-90765PEP)
Publications
Read Publication using NBP1-90765.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22981790)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRBA Antibody

  • CDC4L
  • CDC4-like protein
  • DKFZp686A09128
  • DKFZp686K03100
  • FLJ16600
  • LAB300
  • LBA
  • lipopolysaccharide-responsive and beige-like anchor protein
  • LPS-responsive vesicle trafficking, beach and anchor containing
  • MGC72098
  • vesicle trafficking, beach and anchor containing

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-207
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89165
Species: Hu
Applications: IHC, IHC-P
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29951
Species: Hu, Mu
Applications: WB, Flow, IHC-P
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-13893
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NBP1-32975
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
AF6144
Species: Hu
Applications: WB, Simple Western
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-90765
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for LRBA Antibody (NBP1-90765)(1)

Reviews for LRBA Antibody (NBP1-90765) (0)

There are no reviews for LRBA Antibody (NBP1-90765). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LRBA Antibody (NBP1-90765). (Showing 1 - 1 of 1 FAQ).

  1. I got the NBP1-90765 anti-LRBA lot C104157, I would like to know the antibody concentration in this lot, it is not specified in the vial.
    • For our product NBP1-90765 Lot C104157, the concentration is 0.2mg/ml.

Secondary Antibodies

 

Isotype Controls

Additional LRBA Products

LRBA NBP1-90765

Bioinformatics Tool for LRBA Antibody (NBP1-90765)

Discover related pathways, diseases and genes to LRBA Antibody (NBP1-90765). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRBA Antibody (NBP1-90765)

Discover more about diseases related to LRBA Antibody (NBP1-90765).
 

Pathways for LRBA Antibody (NBP1-90765)

View related products by pathway.

PTMs for LRBA Antibody (NBP1-90765)

Learn more about PTMs related to LRBA Antibody (NBP1-90765).

Blogs on LRBA

There are no specific blogs for LRBA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRBA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRBA
Entrez
Uniprot