LPCAT1 Antibody - BSA Free

Western Blot: LPCAT1 Antibody [NBP1-88922] - Analysis in human cell line BEWO.

Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88922] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88922] - Staining of human cerebral cortex, kidney, liver and lung using Anti-LPCAT1 antibody NBP1-88922 (A) shows similar protein distribution across tissues to independent antibody NBP1-88923 (B).

Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88922] - Analysis in human lung and liver tissues. Corresponding LPCAT1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88922] - Staining of human lung shows moderate to strong cytoplasmic positivity in pneumocytes.

Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88922] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88922] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LPCAT1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AILTLAPHSSYFDAIPVTMTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTC
• Predicted Species: Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LPCAT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Simple Western 1:25 - 1:100
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LPCAT1 Protein (NBP1-88922PEP)

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:32140075).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LPCAT1 Antibody - BSA Free

• 1-acylglycerophosphocholine O-acyltransferase
• Acetyl-CoA:lyso-PAF acetyltransferase
• Acetyl-CoA:lyso-platelet-activating factor acetyltransferase
• acyl-CoA:lysophosphatidylcholine acyltransferase 1
• acyltransferase like 2
• Acyltransferase-like 2
• AYTL2
• EC 2.3.1.-
• EC 2.3.1.23,1-alkylglycerophosphocholine O-acetyltransferase
• EC 2.3.1.67
• FLJ12443
• FLJ41609
• LPC acyltransferase 1
• lpcat
• LPCAT-1
• Lyso-PAF acetyltransferase
• lysoPAFAT
• LysoPC acyltransferase 1
• lysophosphatidylcholine acyltransferase 1
• PFAAP3
• Phosphonoformate immuno-associated protein 3
• regulated by phosphonoformate

Background

Lysophosphatidylcholine (LPC) acyltransferase (LPCAT; EC 2.3.1.23) catalyzes the conversion of LPC tophosphatidylcholine (PC) in the remodeling pathway of PC biosynthesis (Nakanishi et al., 2006 (PubMed16704971)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LPCAT1 Antibody (NBP1-88922)(1)

Publication using NBP1-88922

• Xiao X, Zhuang X, Xu C et al. ROBO4 deletion ameliorates PAF-mediated skin inflammation via regulating the mRNA translation efficiency of LPCAT1/LPCAT2 and the expression of PAF receptor Int. J. Biol. Sci. 2020-02-04 [PMID: 32140075] (WB, Mouse)

Bioinformatics

• Gene Symbol: LPCAT1