LOK Antibody - BSA Free

Immunohistochemistry-Paraffin: LOK Antibody [NBP2-13396] - Analysis in human tonsil and skeletal muscle tissues using NBP2-13396 antibody. Corresponding STK10 RNA-seq data are presented for the same tissues.

Western Blot: LOK Antibody [NBP2-13396] - Analysis in human cell lines SK-MEL-30 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

Immunohistochemistry-Paraffin: LOK Antibody [NBP2-13396] - Staining of human rectum shows strong membranous positivity in lymphoid cells.

Immunohistochemistry-Paraffin: LOK Antibody [NBP2-13396] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: LOK Antibody [NBP2-13396] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: LOK Antibody [NBP2-13396] - Staining of human tonsil shows strong membranous positivity in non-germinal center cells.

Analysis in human tonsil and skeletal muscle tissues using NBP2-13396 antibody. Corresponding STK10 RNA-seq data are presented for the same tissues.

Analysis in human cell lines SK-MEL-30 and HeLa using Anti-STK10 antibody. Corresponding STK10 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LOK Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LOK Antibody - BSA Free (NBP2-13396) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: TLENHTQNSSEVSPPSLNADKPLEESPSTPLAPSQSQDSVNEPCSQPSGDRSLQTTSPPVVAPGNENGLAVPVPLRKSRPVSMDARIQVAQEKQVAEQGG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STK10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LOK Protein (NBP2-13396PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LOK Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.1
• LOKserine/threonine-protein kinase 10
• Lymphocyte-oriented kinase
• PRO2729
• serine/threonine kinase 10

Background

LOK encodes a member of the Ste20 family of serine/threonine protein kinases, and is similar to several known polo-like kinase kinases. The protein can associate with and phosphorylate polo-like kinase 1, and over expression of a kinase dead version of the protein interferes with normal cell cycle progression. The kinase can also negatively regulate interleukin 2 expression in T-cells via the mitogen activated protein kinase 1 pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STK10