LNK/SH2B3 Antibody

Images

 
Western Blot: LNK/SH2B3 Antibody [NBP1-87867] - Analysis in human cell line HELA.
Immunocytochemistry/ Immunofluorescence: LNK/SH2B3 Antibody [NBP1-87867] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: LNK/SH2B3 Antibody [NBP1-87867] - Staining of human lymph node shows strong nuclear membrane positivity in reaction center cells and lymphoid cells outside reaction center.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LNK/SH2B3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FDPPKSSRPKLQAACSSIQEVRRCTRLEMPDNLYTFVLKVKDRTDIIFEVGDEQQLNSWMAELSECTGRGLESTEAEMHIPSALEPSTSSSPRGSTDSLNQGASPGGLLDPACQKTDHFLSCYPWFH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SH2B3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LNK/SH2B3 Protein (NBP1-87867PEP)
Publications
Read Publication using
NBP1-87867 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 25172839).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LNK/SH2B3 Antibody

  • IDDM20
  • LNK
  • LNKSH2B adapter protein 3
  • Lymphocyte adapter protein
  • Lymphocyte-specific adapter protein Lnk
  • SH2B adaptor protein 3
  • SH2B3
  • Signal transduction protein Lnk

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2988
Species: Mu, Rt
Applications: WB
NBP2-13305
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF6915
Species: Hu, Mu, Rt
Applications: WB
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF1016
Species: Hu
Applications: WB, Neut
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
MAB3428
Species: Hu
Applications: WB, IHC
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready

Publications for LNK/SH2B3 Antibody (NBP1-87867)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for LNK/SH2B3 Antibody (NBP1-87867) (0)

There are no reviews for LNK/SH2B3 Antibody (NBP1-87867). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LNK/SH2B3 Antibody (NBP1-87867) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LNK/SH2B3 Products

Bioinformatics Tool for LNK/SH2B3 Antibody (NBP1-87867)

Discover related pathways, diseases and genes to LNK/SH2B3 Antibody (NBP1-87867). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LNK/SH2B3 Antibody (NBP1-87867)

Discover more about diseases related to LNK/SH2B3 Antibody (NBP1-87867).
 

Pathways for LNK/SH2B3 Antibody (NBP1-87867)

View related products by pathway.

PTMs for LNK/SH2B3 Antibody (NBP1-87867)

Learn more about PTMs related to LNK/SH2B3 Antibody (NBP1-87867).

Blogs on LNK/SH2B3

There are no specific blogs for LNK/SH2B3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LNK/SH2B3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH2B3
Entrez