LMTK3 Antibody - BSA Free

Immunohistochemistry-Paraffin: LMTK3 Antibody [NBP2-62711] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: LMTK3 Antibody [NBP2-62711] - Analysis in human cerebral cortex and liver tissues using Anti-LMTK3 antibody. Corresponding LMTK3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: LMTK3 Antibody [NBP2-62711] - Staining of human liver shows low expression as expected.

• Reactivity: Hu, Mu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LMTK3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LMTK3 Antibody - BSA Free (NBP2-62711) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CSCLPLERGDAVAGWGGHPALGCPHPPEDDSSLRAERGSLADLPMAPPASAPPEFLDP
• Predicted Species: Mouse (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LMTK3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LMTK3 Recombinant Protein Antigen (NBP2-62711PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LMTK3 Antibody - BSA Free

• AATYK3
• EC 2.7.11.1
• KIAA1883
• lemur tyrosine kinase 3KIAA1883TYKLM3LMR3
• LMR3
• LMTK3
• PPP1R101
• serine/threonine-protein kinase LMTK3
• TYKLM3

Background

LMTK3, or Lemur Tyrosine Kinase 3, consists of a 1,460 amino acid isoform that is 153,661 kDa, and is considered a membrane protein, though its function is not known. Current research is being conducted on the relationship between LMTK3 and a variety of diseases and disorders, including uterine sarcoma, pancreatitis, thyroid carcinoma, adenocarcinoma, breast cancer, and thyroiditis. LMTK3 has been linked to Paxillin interactions, intracellular calcium signaling, MAPK signaling, Akt signaling, the GPCR pathway, and the Endothelin-1 signaling pathway. The protein interacts with ZBTB16 and PPP1CA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LMTK3