LMOD1 Antibody - BSA Free Summary
Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen |
Synthetic peptides corresponding to LMOD1(leiomodin 1 (smooth muscle)) The peptide sequence was selected from the N terminal of LMOD1.
Peptide sequence SRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQ. The peptide sequence for this immunogen was taken from within the described region. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
LMOD1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for LMOD1 Antibody - BSA Free
Background
The leiomodin 1 protein (LMOD1) has a putative membrane-spanning region and 2 types of tandemly repeated blocks. The transcript is expressed in all tissues tested, with the highest levels in thyroid, eye muscle, skeletal muscle, and ovary. Increased expression of leiomodin 1 may be linked to Graves' disease and thyroid-associated ophthalmopathy.The leiomodin 1 protein has a putative membrane-spanning region and 2 types of tandemly repeated blocks. The transcript is expressed in all tissues tested, with the highest levels in thyroid, eye muscle, skeletal muscle, and ovary. Increased expression of leiomodin 1 may be linked to Graves' disease and thyroid-associated ophthalmopathy.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Species: Ha, Hu, Mu, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, IHC, IHC-P, IP, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Func, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for LMOD1 Antibody (NBP1-57623) (0)
There are no publications for LMOD1 Antibody (NBP1-57623).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LMOD1 Antibody (NBP1-57623) (0)
There are no reviews for LMOD1 Antibody (NBP1-57623).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for LMOD1 Antibody (NBP1-57623) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional LMOD1 Products
Research Areas for LMOD1 Antibody (NBP1-57623)
Find related products by research area.
|
Blogs on LMOD1