LMOD1 Antibody - BSA Free

Western Blot: LMOD1 Antibody [NBP1-57623] - Human Placenta lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

LMOD1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to LMOD1(leiomodin 1 (smooth muscle)) The peptide sequence was selected from the N terminal of LMOD1. Peptide sequence SRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQ. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LMOD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for LMOD1 Antibody - BSA Free

• 64 kDa autoantigen 1D
• 64 kDa autoantigen 1D3,1D
• 64 kDa autoantigen D1,64kD
• D1
• FLJ55689
• leimodin 1 (smooth muscle)
• leiomodin 1 (smooth muscle)
• Leiomodin, muscle form
• leiomodin-1
• SM-LMOD
• Smooth muscle leiomodin
• thyroid and eye muscle autoantigen D1 (64kD)
• Thyroid-associated ophthalmopathy autoantigen

Background

The leiomodin 1 protein (LMOD1) has a putative membrane-spanning region and 2 types of tandemly repeated blocks. The transcript is expressed in all tissues tested, with the highest levels in thyroid, eye muscle, skeletal muscle, and ovary. Increased expression of leiomodin 1 may be linked to Graves' disease and thyroid-associated ophthalmopathy.The leiomodin 1 protein has a putative membrane-spanning region and 2 types of tandemly repeated blocks. The transcript is expressed in all tissues tested, with the highest levels in thyroid, eye muscle, skeletal muscle, and ovary. Increased expression of leiomodin 1 may be linked to Graves' disease and thyroid-associated ophthalmopathy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LMOD1
• Uniprot:
  • P29536(Human)