LMCD1 Antibody

Images

 
Western Blot: LMCD1 Antibody [H00029995-B01P] - Analysis of LMCD1 expression in transfected 293T cell line by LMCD1 polyclonal antibody. Lane 1: LMCD1 transfected lysate(40.15 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: LMCD1 Antibody [H00029995-B01P] - Analysis of purified antibody to LMCD1 on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LMCD1 Antibody Summary

Immunogen
LMCD1 (NP_055398.1, 1 a.a. - 365 a.a.) full-length human protein. MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS
Specificity
LMCD1,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
LMCD1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
Application Notes
This antibody is useful for ELISA, immunofluorescence, and Western Blot.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LMCD1 Antibody

  • dyxin
  • LIM and cysteine-rich domains 1
  • LIM and cysteine-rich domains protein 1

Background

The protein encoded by this gene contains a cysteine-rich domain in the N-terminal region and 2 LIM domains in the C-terminal region. It also has several potential phosphorylation and N-myristoylation sites and a single potential N-glycosylation site. The presence of LIM domains implies involvement in protein-protein interactions. Expression of this gene has been detected in most tissues, with highest expression in skeletal muscle. Transcript variants utilizing alternative polyA signals have been observed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84843
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87992
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-85816
Species: Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
NB100-77341
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-14292
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87987
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1700
Species: Hu
Applications: ChIP, ICC, IHC, WB
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-20154
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00009260-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, IP, KD, S-ELISA, WB
NBP1-80833
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1837
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-27135
Species: Hu
Applications: PEP-ELISA
NBP1-90824
Species: Hu
Applications: ICC/IF, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00029995-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for LMCD1 Antibody (H00029995-B01P) (0)

There are no publications for LMCD1 Antibody (H00029995-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMCD1 Antibody (H00029995-B01P) (0)

There are no reviews for LMCD1 Antibody (H00029995-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LMCD1 Antibody (H00029995-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LMCD1 Products

Bioinformatics Tool for LMCD1 Antibody (H00029995-B01P)

Discover related pathways, diseases and genes to LMCD1 Antibody (H00029995-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMCD1 Antibody (H00029995-B01P)

Discover more about diseases related to LMCD1 Antibody (H00029995-B01P).
 

Pathways for LMCD1 Antibody (H00029995-B01P)

View related products by pathway.

PTMs for LMCD1 Antibody (H00029995-B01P)

Learn more about PTMs related to LMCD1 Antibody (H00029995-B01P).

Blogs on LMCD1

There are no specific blogs for LMCD1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMCD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LMCD1
Entrez
Uniprot