LMCD1 Antibody - Azide and BSA Free

Western Blot: LMCD1 Antibody [H00029995-B01P] - Analysis of LMCD1 expression in transfected 293T cell line by LMCD1 polyclonal antibody. Lane 1: LMCD1 transfected lysate(40.15 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: LMCD1 Antibody [H00029995-B01P] - Analysis of purified antibody to LMCD1 on HeLa cell. (antibody concentration 10 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

LMCD1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse LMCD1 Antibody - Azide and BSA Free (H00029995-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: LMCD1 (NP_055398.1, 1 a.a. - 365 a.a.) full-length human protein. MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS
• Specificity: LMCD1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: LMCD1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: This antibody is useful for ELISA, immunofluorescence, and Western Blot.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LMCD1 Antibody - Azide and BSA Free

• dyxin
• LIM and cysteine-rich domains 1
• LIM and cysteine-rich domains protein 1

Background

The protein encoded by this gene contains a cysteine-rich domain in the N-terminal region and 2 LIM domains in the C-terminal region. It also has several potential phosphorylation and N-myristoylation sites and a single potential N-glycosylation site. The presence of LIM domains implies involvement in protein-protein interactions. Expression of this gene has been detected in most tissues, with highest expression in skeletal muscle. Transcript variants utilizing alternative polyA signals have been observed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LMCD1
• Entrez:
  • 29995(Human)
• Uniprot:
  • NP_055398.1(Human)