LMBRD1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: LMBRD1 Antibody [NBP3-17880] - Staining of human cell line ASC TERT1 shows localization to vesicles.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LMBRD1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QYVMYGSQNYLIETNITSDNHKGNSTLSVPKRCDADAPEDQCTVTRTYLFLHKFW
• Predicted Species: Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LMBRD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LMBRD1 Antibody - BSA Free

• bA810I22.1
• C6orf209
• chromosome 6 open reading frame 209
• FLJ11240
• FLJ11854
• HDAg-L-interacting protein NESI
• hepatitis delta antigen-L interacting protein
• liver regeneration p-53 related protein
• LMBD1
• LMBR1 domain containing 1
• LMBR1 domain-containing protein 1
• NESIcblF
• Nuclear export signal-interacting protein
• probable lysosomal cobalamin transporter

Background

The LMBRD1 gene encodes a lysosomal membrane protein that may be involved in the transport and metabolism of cobalamin. This protein also interacts with the large form of the hepatitis delta antigen and may be required for the nucleocytoplasmic shuttling of the

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LMBRD1