LMBRD1 Antibody - BSA Free

Western Blot: LMBRD1 Antibody [NBP2-85220] - Host: Rabbit. Target Name: LMBRD1. Sample Tissue: Human THP-1 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

LMBRD1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human LMBRD1. Peptide sequence: YLFLHKFWFFSAAYYFGNWAFLGVFLIGLIVSCCKGKKSVIEGVDEDSDI The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LMBRD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for LMBRD1 Antibody - BSA Free

• bA810I22.1
• C6orf209
• chromosome 6 open reading frame 209
• FLJ11240
• FLJ11854
• HDAg-L-interacting protein NESI
• hepatitis delta antigen-L interacting protein
• liver regeneration p-53 related protein
• LMBD1
• LMBR1 domain containing 1
• LMBR1 domain-containing protein 1
• NESIcblF
• Nuclear export signal-interacting protein
• probable lysosomal cobalamin transporter

Background

The LMBRD1 gene encodes a lysosomal membrane protein that may be involved in the transport and metabolism of cobalamin. This protein also interacts with the large form of the hepatitis delta antigen and may be required for the nucleocytoplasmic shuttling of the

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LMBRD1