LKB1/STK11 Antibody

Images

 
Western Blot: LKB1/STK11 Antibody [NBP2-56895] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: LKB1/STK11 Antibody [NBP2-56895] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LKB1/STK11 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIR
Specificity
Specificity of human LKB1/STK11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STK11
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
LKB1/STK11 Knockout 293T Cell Lysate
Control Peptide
LKB1/STK11 Recombinant Protein Antigen (NBP2-56895PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for LKB1/STK11 Antibody

  • EC 2.7.11.1
  • LKB1 serine/threonine kinase 11 (Peutz-Jeghers syndrome)
  • LKB1
  • PJS polarization-related protein LKB1
  • PJS
  • Renal carcinoma antigen NY-REN-19
  • serine/threonine kinase 11
  • serine/threonine-protein kinase 11
  • Serine/threonine-protein kinase LKB1
  • STK11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
H00005564-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, S-ELISA
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow, KO
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-17187
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15658
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC
H00010645-M02
Species: Hu, Bv
Applications: WB, ELISA, S-ELISA, KD
H00003845-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
NB100-2315
Species: Hu, Mu
Applications: WB, IP
NBP2-89114
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56895
Species: Hu
Applications: WB, ICC/IF

Publications for LKB1/STK11 Antibody (NBP2-56895) (0)

There are no publications for LKB1/STK11 Antibody (NBP2-56895).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LKB1/STK11 Antibody (NBP2-56895) (0)

There are no reviews for LKB1/STK11 Antibody (NBP2-56895). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LKB1/STK11 Antibody (NBP2-56895) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LKB1/STK11 Products

Bioinformatics Tool for LKB1/STK11 Antibody (NBP2-56895)

Discover related pathways, diseases and genes to LKB1/STK11 Antibody (NBP2-56895). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LKB1/STK11 Antibody (NBP2-56895)

Discover more about diseases related to LKB1/STK11 Antibody (NBP2-56895).
 

Pathways for LKB1/STK11 Antibody (NBP2-56895)

View related products by pathway.

PTMs for LKB1/STK11 Antibody (NBP2-56895)

Learn more about PTMs related to LKB1/STK11 Antibody (NBP2-56895).
 

Research Areas for LKB1/STK11 Antibody (NBP2-56895)

Find related products by research area.

Blogs on LKB1/STK11

There are no specific blogs for LKB1/STK11, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LKB1/STK11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STK11