LKB1/STK11 Antibody - BSA Free

Immunohistochemistry-Paraffin: LKB1/STK11 Antibody [NBP1-87817] - Staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: LKB1/STK11 Antibody [NBP1-87817] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: LKB1/STK11 Antibody [NBP1-87817] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: LKB1/STK11 Antibody [NBP1-87817] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LKB1/STK11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LKB1/STK11 Antibody - BSA Free (NBP1-87817) is a polyclonal antibody validated for use in IHC. Anti-LKB1/STK11 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQ
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STK11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: IHC reported in scientific literature (PMID: 25042259). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LKB1/STK11 Protein (NBP1-87817PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25042259).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LKB1/STK11 Antibody - BSA Free

• EC 2.7.11.1
• LKB1 serine/threonine kinase 11 (Peutz-Jeghers syndrome)
• LKB1
• PJS polarization-related protein LKB1
• PJS
• Renal carcinoma antigen NY-REN-19
• serine/threonine kinase 11
• serine/threonine-protein kinase 11
• Serine/threonine-protein kinase LKB1
• STK11

Background

Peutz-Jeghers syndrome (PJS) is a rare hereditary disease characterized by melanocytic macules lips, gastrointestinal hamartomatous polyps and an increased risk for many classes of cancer. LKB1 (also designated STK11 and PJS) has been identified as the gene mutated in PJS. LKB1 is a 433 amino acid Serine/Threonine kinase with strong homology to the Xenopus cytoplasmic protein kinase XEEK1 and weaker similarity to many other protein kinases. LKB1 is ubiquitously expressed and many frameshift, deletion and splicing mutations have been identified in PJS patients. Despite the increased risk of cancer for PJS patients, LKB1 does not appear to play a major role in colorectal, testicular or breast cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LKB1/STK11 Antibody (NBP1-87817)(1)

Publication using NBP1-87817

• Co NN, Iglesias D, Celestino J et al. Loss of LKB1 in High Grade Endometrial Carcinoma: LKB1 is a Novel Transcriptional Target of p53. Cancer 2014-11-15 [PMID: 25042259] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: STK11