LIX1 Antibody

Images

 
Immunohistochemistry-Paraffin: LIX1 Antibody [NBP2-31556] - Staining of human cerebral cortex shows moderate positivity in neuropil.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LIX1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RRITKEFIMESVQEAVASTSGTLDDADDPSTSVGAYHYMLESNMGKT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LIX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LIX1 Protein (NBP2-31556PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LIX1 Antibody

  • C5orf11
  • chromosome 5 open reading frame 11
  • FLJ25534
  • limb expression 1
  • Lix1 homolog (chicken)
  • Lix1 homolog (mouse)
  • protein limb expression 1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6386
Species: Hu
Applications: WB, IP
NBP2-45897
Species: Hu
Applications: WB, IHC
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13881
Species: Hu
Applications: WB, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91988
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-2693
Species: Dr
Applications: WB, ELISA, ICC/IF, IHC
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LIX1 Antibody (NBP2-31556) (0)

There are no publications for LIX1 Antibody (NBP2-31556).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIX1 Antibody (NBP2-31556) (0)

There are no reviews for LIX1 Antibody (NBP2-31556). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LIX1 Antibody (NBP2-31556) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LIX1 Products

Bioinformatics Tool for LIX1 Antibody (NBP2-31556)

Discover related pathways, diseases and genes to LIX1 Antibody (NBP2-31556). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIX1 Antibody (NBP2-31556)

Discover more about diseases related to LIX1 Antibody (NBP2-31556).
 

Pathways for LIX1 Antibody (NBP2-31556)

View related products by pathway.

Blogs on LIX1

There are no specific blogs for LIX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LIX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LIX1
Uniprot