FAT1 Antibody

Images

 
Immunohistochemistry-Paraffin: FAT1 Antibody [NBP1-84565] - Staining of human rectum shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: FAT1 Antibody [NBP1-84565] - Staining of human prostate shows moderate membranous and cytoplasmic positivity in smooth muscle cells and glandular cells.
Immunohistochemistry-Paraffin: FAT1 Antibody [NBP1-84565] - Staining of human skeletal muscle shows very weak positivity in myocytes.
Immunohistochemistry-Paraffin: FAT1 Antibody [NBP1-84565] - Staining of human skin shows moderate membranous positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NFQRALRNILGVRRNDIQIVSLQSSEPHPHLDVLLFVEKPGSAQISTKQLLHKINSSVTDIEEIIGVRILNVFQKLCAGLDCPWKFCDEKVSVDESVMSTHSTARLSFVTPRHHRAAVCLCKEGRCP
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAT1 Protein (NBP1-84565PEP)
Publications
Read Publications using
NBP1-84565 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse (88%). Reactivity reported in scientific literature (PMID: 23354438)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAT1 Antibody

  • FAT tumor suppressor 1
  • FAT tumor suppressor homolog 1 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7940
Species: Hu
Applications: IHC, WB
NBP1-87964
Species: Hu
Applications: IHC, IHC-P
NBP1-86687
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-82648
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-53235
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
MAB3304
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
AF7164
Species: Hu
Applications: WB
NBP1-78381
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO, WB
AF6278
Species: Hu, Mu
Applications: WB
AF1927
Species: Hu
Applications: ICC, IP, WB
NBP1-87914
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1443
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP3-05516
Species: Hu
Applications: IHC, IHC-P
NBP2-00555
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB110-58358
Species: Ca, Hu, Mu, Rt, Ze
Applications: ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB

Publications for FAT1 Antibody (NBP1-84565)(5)

Reviews for FAT1 Antibody (NBP1-84565) (0)

There are no reviews for FAT1 Antibody (NBP1-84565). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FAT1 Antibody (NBP1-84565) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAT1 Products

Array NBP1-84565

Bioinformatics Tool for FAT1 Antibody (NBP1-84565)

Discover related pathways, diseases and genes to FAT1 Antibody (NBP1-84565). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAT1 Antibody (NBP1-84565)

Discover more about diseases related to FAT1 Antibody (NBP1-84565).
 

Pathways for FAT1 Antibody (NBP1-84565)

View related products by pathway.

PTMs for FAT1 Antibody (NBP1-84565)

Learn more about PTMs related to FAT1 Antibody (NBP1-84565).
 

Research Areas for FAT1 Antibody (NBP1-84565)

Find related products by research area.

Blogs on FAT1

There are no specific blogs for FAT1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAT1