LIV-1/Zip6 Antibody

Images

 
Western Blot: LIV-1/Zip6 Antibody [NBP2-13337] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: LIV-1/Zip6 Antibody [NBP2-13337] - Staining of human uterus, post-menopause shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LIV-1/Zip6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HSHHNHAASGKNKRKALCPDHDSDSSGKDPRNSQGKGAHRPEHASGRRNV KDSVSASEVTSTVYNTVSEGTHFLETIETPRPGKLFPKDVSSSTPPSVTS KSRVSRLAGRKTNESVSEPRKGFMYSRNTNENPQE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC39A6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LIV-1/Zip6 Protein (NBP2-13337PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LIV-1/Zip6 Antibody

  • zinc transporter ZIP6
  • LIV-1
  • solute carrier family 39 (zinc transporter), member 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76962
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC
NBP2-55609
Species: Hu
Applications: WB, ICC/IF
NBP1-76504
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-76498
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-86825
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-00153
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-69296
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76505
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-76510
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-76507
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF5617
Species: Hu
Applications: WB
NBP1-76499
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for LIV-1/Zip6 Antibody (NBP2-13337) (0)

There are no publications for LIV-1/Zip6 Antibody (NBP2-13337).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIV-1/Zip6 Antibody (NBP2-13337) (0)

There are no reviews for LIV-1/Zip6 Antibody (NBP2-13337). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LIV-1/Zip6 Antibody (NBP2-13337) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LIV-1/Zip6 Products

Bioinformatics Tool for LIV-1/Zip6 Antibody (NBP2-13337)

Discover related pathways, diseases and genes to LIV-1/Zip6 Antibody (NBP2-13337). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIV-1/Zip6 Antibody (NBP2-13337)

Discover more about diseases related to LIV-1/Zip6 Antibody (NBP2-13337).
 

Pathways for LIV-1/Zip6 Antibody (NBP2-13337)

View related products by pathway.

PTMs for LIV-1/Zip6 Antibody (NBP2-13337)

Learn more about PTMs related to LIV-1/Zip6 Antibody (NBP2-13337).

Blogs on LIV-1/Zip6

There are no specific blogs for LIV-1/Zip6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LIV-1/Zip6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC39A6