SLC39A5 Antibody


Western Blot: SLC39A5 Antibody [NBP1-69296] - This Anti-SLC39A5 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 0.5ug/ml.
Immunohistochemistry: SLC39A5 Antibody [NBP1-69296] - Human Liver.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

SLC39A5 Antibody Summary

Synthetic peptides corresponding to SLC39A5(solute carrier family 39 (metal ion transporter), member 5) The peptide sequence was selected from the N terminal of SLC39A5. Peptide sequence MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC39A5 Antibody

  • LZT-Hs7
  • MGC34778
  • solute carrier family 39 (metal ion transporter), member 5
  • Solute carrier family 39 member 5
  • zinc transporter ZIP5
  • ZIP5
  • ZIP-5
  • Zrt- and Irt-like protein 5


Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A5 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A5 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003).[supplied by OMIM].


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu

Publications for SLC39A5 Antibody (NBP1-69296) (0)

There are no publications for SLC39A5 Antibody (NBP1-69296).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC39A5 Antibody (NBP1-69296) (0)

There are no reviews for SLC39A5 Antibody (NBP1-69296). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC39A5 Antibody (NBP1-69296). (Showing 1 - 1 of 1 FAQ).

  1. I am interested in antibody NBP1-69296, and I see two bands in the WB result in the datasheet at around 56kDa and another band at around 42kDa. I've checked in uniprot, Uniprot, and found no isoforms of this protein.
    • From Uniprot, this protein has an expected molecular weight of 56kDa. So I would expect to see this band in samples where the full protein is present. This protein does also have a signal peptide. I would assume that the smaller band (42kDa) is the cleaved protein (without the signal peptide). Depending on the samples, this band may or may not be present. You may need to research the literature to see how to induce this cleavage or what tissues are suppose to express the cleaved protein to be sure.

Secondary Antibodies


Isotype Controls

Additional SLC39A5 Products

Bioinformatics Tool for SLC39A5 Antibody (NBP1-69296)

Discover related pathways, diseases and genes to SLC39A5 Antibody (NBP1-69296). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC39A5 Antibody (NBP1-69296)

Discover more about diseases related to SLC39A5 Antibody (NBP1-69296).

Pathways for SLC39A5 Antibody (NBP1-69296)

View related products by pathway.

Blogs on SLC39A5

There are no specific blogs for SLC39A5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC39A5 Antibody and receive a gift card or discount.


Gene Symbol SLC39A5