LIR-6/LILRA1 Antibody - BSA Free

Western Blot: LIR-6/LILRA1 Antibody [NBP3-09438] - Western blot analysis of LIR-6/LILRA1 in MDA-MB-435S Whole Cell lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

LIR-6/LILRA1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human LIR-6/LILRA1. Peptide sequence FGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAY
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LILRA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for LIR-6/LILRA1 Antibody - BSA Free

• CD85 antigen-like family member I
• CD85i antigen
• CD85i
• leukocyte immunoglobulin-like receptor subfamily A member 1 soluble isoform
• leukocyte immunoglobulin-like receptor subfamily A member 1
• leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 1
• LILRA1
• LIR6
• LIR-6
• LIR-6Leukocyte immunoglobulin-like receptor 6
• LIR6MGC126563

Background

LILRA3 is a member of leukocyte immunoglobulin-like receptor gene family. Leukocyte Ig-like receptors (LIRs) are a family of inhibitory and stimulatory immunoreceptors expressed predominantly on monocytes and B cells and at lower levels on dendritic cells and natural killer (NK) cells. LILRA3 lacks a transmembrane region and may act as a soluble receptor for class I MHC antigens. It is expressed in B-cells, and at lower levels in natural killer (NK) cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LILRA1