Lipin 3 Antibody

Images

 
Immunohistochemistry-Paraffin: Lipin 3 Antibody [NBP2-31920] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Lipin 3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FFVQELESDDEHVPPGLCTSPIPWGGLSGFPSDSQLGTASEPEGLVMAGTASTGRRKRRRRRKPKQKEDAVATDSSP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LPIN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Lipin 3 Protein (NBP2-31920PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lipin 3 Antibody

  • dJ450M14.2
  • dJ450M14.3
  • dJ620E11.2
  • EC 3.1.3.4
  • Lipin 3
  • lipin 3-like
  • lipin-3
  • Lipin-3-like
  • LIPN3L
  • LPIN3
  • phosphatidate phosphatase LPIN3
  • SMP2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-57150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF3756
Species: Hu, Mu, Rt
Applications: WB
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-56262
Species: Hu
Applications: ICC/IF
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
NBP2-20464
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-74340
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for Lipin 3 Antibody (NBP2-31920) (0)

There are no publications for Lipin 3 Antibody (NBP2-31920).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lipin 3 Antibody (NBP2-31920) (0)

There are no reviews for Lipin 3 Antibody (NBP2-31920). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Lipin 3 Antibody (NBP2-31920) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lipin 3 Products

Bioinformatics Tool for Lipin 3 Antibody (NBP2-31920)

Discover related pathways, diseases and genes to Lipin 3 Antibody (NBP2-31920). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lipin 3 Antibody (NBP2-31920)

Discover more about diseases related to Lipin 3 Antibody (NBP2-31920).
 

Pathways for Lipin 3 Antibody (NBP2-31920)

View related products by pathway.

Blogs on Lipin 3

There are no specific blogs for Lipin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lipin 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LPIN3
Entrez
Uniprot