Lipin 3 Antibody

Images

 
Immunohistochemistry-Paraffin: Lipin 3 Antibody [NBP2-31920] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Lipin 3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FFVQELESDDEHVPPGLCTSPIPWGGLSGFPSDSQLGTASEPEGLVMAGTASTGRRKRRRRRKPKQKEDAVATDSSP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LPIN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Lipin 3 Protein (NBP2-31920PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lipin 3 Antibody

  • dJ450M14.2
  • dJ450M14.3
  • dJ620E11.2
  • EC 3.1.3.4
  • Lipin 3
  • lipin 3-like
  • lipin-3
  • Lipin-3-like
  • LIPN3L
  • LPIN3
  • phosphatidate phosphatase LPIN3
  • SMP2

Background

Humans lipodystrophy is characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mice carrying mutations in the fatty liver dystrophy (fld) gene have similar phenotypes. Through positional cloning, the mouse gene responsible for fatty liver dystrophy was isolated and designated Lpin1. The nuclear protein encoded by Lpin1 was named lipin. Lpin1 mRNA was expressed at high levels in adipose tissue and was induced during differentiation of preadipocytes. These results indicated that lipin is required for normal adipose tissue development and provided a candidate gene for human lipodystrophy. Through database searches, mouse and human EST and genomic sequences with similarities to Lpin1 were identified. These included two related mouse genes (Lpin2 and Lpin3) and three human homologs (LPIN1, LPIN2, and LPIN3). Human LPIN1 gene has been mapped to 2p25.; linkages of fat mass and serum leptin levels to this same region have been noted. Human LPIN2 and LPIN3 mapped to chromosomes 18p11 and 20q11-q12, respectively. The mouse genes encoding Lpin1, Lpin2, and Lpin3 mapped to chromosome 12, 17, and 2, respectively.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-57150
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF3756
Species: Hu, Mu, Rt
Applications: WB
NBP2-24763
Species: Hu, Pm
Applications: IHC, IHC-P, WB
NBP3-20223
Species: Hu
Applications: ICC/IF, IP, WB
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP1-87345
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87343
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-48909
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP3-04411
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-24614
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-56262
Species: Hu
Applications: ICC/IF
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-23368
Species: Hu
Applications: PAGE
NBP2-20464
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-74340
Species: Bv, ChHa, Dr, Fu, Hu, Mu, Pl, Pr, Rb, Rt, Sh, Xp, Ye, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB

Publications for Lipin 3 Antibody (NBP2-31920) (0)

There are no publications for Lipin 3 Antibody (NBP2-31920).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lipin 3 Antibody (NBP2-31920) (0)

There are no reviews for Lipin 3 Antibody (NBP2-31920). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Lipin 3 Antibody (NBP2-31920) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lipin 3 Products

Diseases for Lipin 3 Antibody (NBP2-31920)

Discover more about diseases related to Lipin 3 Antibody (NBP2-31920).
 

Pathways for Lipin 3 Antibody (NBP2-31920)

View related products by pathway.

Blogs on Lipin 3

There are no specific blogs for Lipin 3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lipin 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LPIN3
Uniprot