LIPH Antibody

Images

 
Immunohistochemistry-Paraffin: LIPH Antibody [NBP2-14194] Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LIPH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GCPKTILGGFQYFKCDHQRSVYLYLSSLRESCTITAYPCDSYQDYRNGKC VSCGTSQKESCPLLGYYADNWKDHL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LIPH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LIPH Protein (NBP2-14194PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LIPH Antibody

  • ARWH2
  • EC 3.1.1
  • EC 3.1.1.-
  • EC 3.1.1.3
  • LAH2
  • lipase H
  • lipase member H
  • lipase, member H
  • LPD lipase-related protein
  • LPDLR
  • Membrane-associated phosphatidic acid-selective phospholipase A1-alpha
  • membrane-bound phosphatidic acid-selective phospholipase A1
  • mPA-PLA1 alpha
  • MPAPLA1
  • mPA-PLA1
  • Phospholipase A1 member B
  • PLA1BAH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-24722
Species: Hu
Applications: WB, IHC-P
H00005545-R02
Species: Hu
NBP2-29917
Species: Hu
Applications: WB, ICC/IF, IHC-P
H00001551-B01P
Species: Hu
Applications: WB
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00057491-R01
Species: Hu

Publications for LIPH Antibody (NBP2-14194) (0)

There are no publications for LIPH Antibody (NBP2-14194).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIPH Antibody (NBP2-14194) (0)

There are no reviews for LIPH Antibody (NBP2-14194). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LIPH Antibody (NBP2-14194) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LIPH Products

Bioinformatics Tool for LIPH Antibody (NBP2-14194)

Discover related pathways, diseases and genes to LIPH Antibody (NBP2-14194). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIPH Antibody (NBP2-14194)

Discover more about diseases related to LIPH Antibody (NBP2-14194).
 

Pathways for LIPH Antibody (NBP2-14194)

View related products by pathway.

PTMs for LIPH Antibody (NBP2-14194)

Learn more about PTMs related to LIPH Antibody (NBP2-14194).

Blogs on LIPH

There are no specific blogs for LIPH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LIPH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LIPH