LIMPII/SR-B2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

LIMPII/SR-B2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SCARB2.
  
  

  Source: E. coli

  Amino Acid Sequence: SFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAEILANTSDNAGFCIPEGNCLGSGVLNVSICKNGAPIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: SCARB2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84583.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LIMPII/SR-B2 Recombinant Protein Antigen

• AMRF
• CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 2(lysosomal integral membrane protein II)
• CD36 antigen
• CD36L2
• CD36L2LIMP II
• HLGP85
• LGP85
• LIMP-2,85 kDa lysosomal sialoglycoprotein scavenger receptor class B, member 2
• LIMPII
• LIMPIICD36 antigen-like 2
• LPG85
• lysosome membrane protein 2
• Lysosome membrane protein II
• SCARB2
• Scavenger receptor class B member 2,85 kDa lysosomal membrane sialoglycoprotein
• scavenger receptor class B, member 2
• SRB2
• SR-B2
• SR-BII

Background

High density lipoproteins (HDLs) play a critical role in cholesterol metabolism and their plasma concentrations are inversely correlated with risk for atherosclerosis. SR-BI and SR-BII (previously known as SR-BI.2) are the alternatively spliced products of a single gene. SR-BII differs from SR-BI in that the encoded c-terminal cytoplasmic domain is almost completely different. SR-BII binds HDLs and mediates selective uptake of HDL cholesteryl ester, but with an approximately 4-fold lower efficiency than SR-BI. Nuclease protection assays show SR-BII to be abundant in mouse tissues expressing SR-BI, with SR-BII expression found in liver, adrenal glands, and testes. Although the role of SR-BII is not completely clear, research suggests that it may be a functional HDL receptor. In addition, SR-BII mRNA results from the alternative splicing of SR-BI precursor transcripts with the SR-BII isoform mediating selective transfer of lipid between HDL and cells. The relative expression and functional activities of these two isoforms create a potential means of regulating selective lipid transfer between HDL and cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: SCARB2