Lhx4 Antibody (2B12) - Azide and BSA Free Summary
                         
                                
                                
                                
            | Description | 
            Novus Biologicals Mouse Lhx4 Antibody (2B12) - Azide and BSA Free (H00089884-M03) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.  | 
        
            | Immunogen | 
            LHX4 (NP_203129, 208 a.a. ~ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RRAKEKRLKKDAGRHRWGQFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQDLRDGS  | 
        
            | Specificity | 
            LHX4 - LIM homeobox 4  | 
        
            | Isotype | 
            IgG2a Kappa  | 
        
            | Clonality | 
            Monoclonal  | 
        
            | Host | 
            Mouse  | 
        
            | Gene | 
            LHX4  | 
        
            | Purity | 
            IgG purified  | 
        
            | Innovator's Reward | 
            Test in a species/application not listed above to receive a full credit towards a future purchase.  | 
        
                                
                          Applications/Dilutions
                                
                                    
                                    
                                        
                              
                                  | Dilutions | 
                                  
                                      - ELISA 
 - Immunocytochemistry/ Immunofluorescence 
 - Sandwich ELISA 
 - Western Blot 1:500
 
                                       
                                   | 
                              
            | Application Notes | 
            Antibody reactive against tissue lysate and recombinant protein for western blot. It has also been used for ELISA.  | 
        
                                    
                                 Reactivity Notes
                        
                                
                                        
                                        Human. Other species not tested.
                                          Packaging, Storage & Formulations
            | Storage | 
            Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.  | 
        
            | Buffer | 
            In 1x PBS, pH 7.4  | 
        
            | Preservative | 
            No Preservative  | 
        
            | Purity | 
            IgG purified  | 
        
  Notes
                    
                        This product is produced by and distributed for Abnova, a company based in Taiwan.
                     Alternate Names for Lhx4 Antibody (2B12) - Azide and BSA Free
                     Background
 
                    
                    This gene encodes a member of a large protein family which contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and be involved in control of differentiation and development of the pituitary gland. Mutations in this gene are associated with syndromic short stature and pituitary and hindbrain defects. An alternative splice variant has been described but its biological nature has not been determined.
                      Limitations
 
                    
                    This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are 
guaranteed for 1 year from date of receipt.
 
                     Customers Who Viewed This Item Also Viewed...
                
                
                            
                                  
                                       Species: Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
                                     
                                 
                             
                            
                                  
                                       
                                                Species: Hu, Mu
Applications: IHC,  IHC-P
                                     
                                 
                              
                            
                                  
                                       Species: Hu
Applications: IHC,  IHC-P
                                     
                                 
                             
                            
                                  
                                       Species: Hu
Applications: WB
                                     
                                 
                              
                            
                                  
                                       
                                                Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
                                     
                                 
                             
                            
                                  
                                       
                                                Species: Hu
Applications: IHC,  IHC-P, WB
                                     
                                 
                              
                            
                                  
                                       
                                                Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
                                     
                                 
                             
                            
                                  
                                       
                                                Species: Hu
Applications: ICC, WB
                                     
                                 
                              
                            
                                  
                                       
                                                Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
                                     
                                 
                             
                            
                                  
                                       
                                                Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
                                     
                                 
                              
                            
                                  
                                       Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
                                     
                                 
                             
                            
                                  
                                       
                                                Species: Hu
Applications: IHC
                                     
                                 
                              
                            
                                  
                                       
                                                
                                                Species: Hu
Applications: ICC, IHC, Simple Western, WB
                                     
                                 
                             
                            
                                  
                                       
                                                Species: Hu
Applications: IHC,  IHC-P
                                     
                                 
                              
                            
                                  
                                       
                                                
                                                Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
                                     
                                 
                             
                            
                                  
                                       
                                                Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
                                     
                                 
                              
                            
                                  
                                       
                                                Species: Hu
Applications: ICC, IHC, Simple Western, WB
                                     
                                 
                             
                            
                                  
                                       
                                                
                                                Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
                                     
                                 
                              
                            
                                  
                                       
                                                Species: Hu, Mu
Applications:  IHC-P, WB
                                     
                                 
                             
                            
                                  
                                       
                                                
                                                Species: Mu
Applications: IHC, WB
                                     
                                 
                              
                      
                  
            
                        
                        Publications for Lhx4 Antibody (H00089884-M03) (0)
             
            
                        There are no publications for Lhx4 Antibody (H00089884-M03).
                        By submitting your publication information earn gift cards and discounts for future purchases.
             
            
                        
                        Reviews for Lhx4 Antibody (H00089884-M03) (0)	
                        
                        There are no reviews for Lhx4 Antibody (H00089884-M03).
                        By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount. 
                            
                                - Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
 
                                - Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
 
                            
                                   
                  Product General Protocols
                        
                        Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
                        
Video Protocols
                        
                          FAQs for Lhx4 Antibody (H00089884-M03) (0)
                        
                             
                  
                Secondary Antibodies
                    
                      |   | 
                Isotype Controls
                    
                     | 
Additional Lhx4 Products
                            
                            Blogs on Lhx4