LHX2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LHX2 Antibody [NBP2-55153] - Staining of human cell line MCF7 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LHX2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFEALLQGEYPAHFNHADVAAAAAAAAAAKSAGLGSAGANPLGLPYYNGVGTVQKGRPRKRKSPGPGADLAAYN
Specificity
Specificity of human LHX2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LHX2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LHX2 Recombinant Protein Antigen (NBP2-55153PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for LHX2 Antibody

  • hLhx2
  • Homeobox protein LH-2
  • LH-2
  • LH2MGC138390
  • LIM homeobox 2
  • LIM homeobox protein 2
  • LIM HOX gene 2
  • LIM/homeobox protein Lhx2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38770
Species: Hu, Mu
Applications: WB
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005352-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-81307
Species: Hu
Applications: WB, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Fi, Pm, Pm, Sh
Applications: WB, ICC/IF, IHC, IP
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP1-86114
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31362
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00030062-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB600-480
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP1-84476
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01926
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82478
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1979
Species: Hu
Applications: WB, Simple Western, IHC, ICC
AF2567
Species: Mu
Applications: WB, IHC
NBP2-55153
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for LHX2 Antibody (NBP2-55153) (0)

There are no publications for LHX2 Antibody (NBP2-55153).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LHX2 Antibody (NBP2-55153) (0)

There are no reviews for LHX2 Antibody (NBP2-55153). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LHX2 Antibody (NBP2-55153) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LHX2 Products

Bioinformatics Tool for LHX2 Antibody (NBP2-55153)

Discover related pathways, diseases and genes to LHX2 Antibody (NBP2-55153). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LHX2 Antibody (NBP2-55153)

Discover more about diseases related to LHX2 Antibody (NBP2-55153).
 

Pathways for LHX2 Antibody (NBP2-55153)

View related products by pathway.

PTMs for LHX2 Antibody (NBP2-55153)

Learn more about PTMs related to LHX2 Antibody (NBP2-55153).

Blogs on LHX2

There are no specific blogs for LHX2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LHX2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LHX2