Leukotriene B4 Receptor 2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Leukotriene B4 Receptor 2 Antibody [NBP2-57352] - Staining of human cell line A549 shows localization to nucleoplasm & plasma membrane.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Leukotriene B4 Receptor 2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL
Specificity
Specificity of human Leukotriene B4 Receptor 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LTB4R2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Leukotriene B4 Receptor 2 Recombinant Protein Antigen (NBP2-57352PEP)

Reactivity Notes

Rat 80%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Leukotriene B4 Receptor 2 Antibody

  • BLT2
  • BLT2LTB4 receptor JULF2
  • BLT2R
  • BLTR2
  • BLTR2LTB4-R2
  • JULF2
  • KPG_004
  • Leukotriene B4 R2
  • leukotriene B4 receptor 2
  • Leukotriene B4 receptor BLT2
  • Leukotriene B4R2
  • LTB4-R 2
  • LTB4R2
  • NOP9
  • Seven transmembrane receptor BLTR2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27422
Species: Hu, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-14207
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, In vitro, CyTOF-ready
NBP1-31546
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NLS418
Species: Hu
Applications: IHC, IHC-P
NLS2756
Species: Hu, Pm
Applications: IHC, IHC-P, ICC
NLS442
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P
NLS2272
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
NBP2-57352
Species: Hu
Applications: ICC/IF

Publications for Leukotriene B4 Receptor 2 Antibody (NBP2-57352) (0)

There are no publications for Leukotriene B4 Receptor 2 Antibody (NBP2-57352).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Leukotriene B4 Receptor 2 Antibody (NBP2-57352) (0)

There are no reviews for Leukotriene B4 Receptor 2 Antibody (NBP2-57352). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Leukotriene B4 Receptor 2 Antibody (NBP2-57352) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Leukotriene B4 Receptor 2 Products

Bioinformatics Tool for Leukotriene B4 Receptor 2 Antibody (NBP2-57352)

Discover related pathways, diseases and genes to Leukotriene B4 Receptor 2 Antibody (NBP2-57352). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Leukotriene B4 Receptor 2 Antibody (NBP2-57352)

Discover more about diseases related to Leukotriene B4 Receptor 2 Antibody (NBP2-57352).
 

Pathways for Leukotriene B4 Receptor 2 Antibody (NBP2-57352)

View related products by pathway.

PTMs for Leukotriene B4 Receptor 2 Antibody (NBP2-57352)

Learn more about PTMs related to Leukotriene B4 Receptor 2 Antibody (NBP2-57352).
 

Research Areas for Leukotriene B4 Receptor 2 Antibody (NBP2-57352)

Find related products by research area.

Blogs on Leukotriene B4 Receptor 2

There are no specific blogs for Leukotriene B4 Receptor 2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Leukotriene B4 Receptor 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LTB4R2