Leukotriene B4 Receptor 2 Antibody


Immunohistochemistry: Leukotriene B4 Receptor 2 Antibody [NBP1-89960] - Staining of human fallopian tube shows distinct positivity in ciliated cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Leukotriene B4 Receptor 2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSR
Specificity of human Leukotriene B4 Receptor 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Leukotriene B4 Receptor 2 Protein (NBP1-89960PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Leukotriene B4 Receptor 2 Antibody

  • BLT2
  • BLT2LTB4 receptor JULF2
  • BLT2R
  • BLTR2
  • BLTR2LTB4-R2
  • JULF2
  • KPG_004
  • Leukotriene B4 R2
  • leukotriene B4 receptor 2
  • Leukotriene B4 receptor BLT2
  • Leukotriene B4R2
  • LTB4-R 2
  • LTB4R2
  • NOP9
  • Seven transmembrane receptor BLTR2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Hu
Applications: IHC-P
Species: Hu, Mk
Applications: IHC-P, ICC
Species: Hu
Applications: IHC-P
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for Leukotriene B4 Receptor 2 Antibody (NBP1-89960) (0)

There are no publications for Leukotriene B4 Receptor 2 Antibody (NBP1-89960).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Leukotriene B4 Receptor 2 Antibody (NBP1-89960) (0)

There are no reviews for Leukotriene B4 Receptor 2 Antibody (NBP1-89960). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Leukotriene B4 Receptor 2 Antibody (NBP1-89960) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Leukotriene B4 Receptor 2 Products

Bioinformatics Tool for Leukotriene B4 Receptor 2 Antibody (NBP1-89960)

Discover related pathways, diseases and genes to Leukotriene B4 Receptor 2 Antibody (NBP1-89960). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Leukotriene B4 Receptor 2 Antibody (NBP1-89960)

Discover more about diseases related to Leukotriene B4 Receptor 2 Antibody (NBP1-89960).

Pathways for Leukotriene B4 Receptor 2 Antibody (NBP1-89960)

View related products by pathway.

PTMs for Leukotriene B4 Receptor 2 Antibody (NBP1-89960)

Learn more about PTMs related to Leukotriene B4 Receptor 2 Antibody (NBP1-89960).

Research Areas for Leukotriene B4 Receptor 2 Antibody (NBP1-89960)

Find related products by research area.

Blogs on Leukotriene B4 Receptor 2

There are no specific blogs for Leukotriene B4 Receptor 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Leukotriene B4 Receptor 2 Antibody and receive a gift card or discount.


Gene Symbol LTB4R2