LETMD1 Antibody - BSA Free

Western Blot: LETMD1 Antibody [NBP3-04759] - Analysis of extracts of various cell lines, using LETMD1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

Immunohistochemistry-Paraffin: LETMD1 Antibody [NBP3-04759] - Immunohistochemistry of paraffin-embedded Rat testis using LETMD1 Rabbit pAb (NBP3-04759) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: LETMD1 Antibody [NBP3-04759] - Immunohistochemistry of paraffin-embedded Human colon using LETMD1 Rabbit pAb (NBP3-04759) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: LETMD1 Antibody [NBP3-04759] - Immunohistochemistry of paraffin-embedded Mouse kidney using LETMD1 Rabbit pAb (NBP3-04759) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LETMD1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LETMD1 Antibody - BSA Free (NBP3-04759) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 161-360 of human LETMD1 (NP_056231.3). FPRQLLIRHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEKVIPLISDAGLRWRLTDLCTKIQRGTHPAIHDILALRECFSNHPLGMNQLQALHVKALSRAMLLTSYLPPPLLRHRLKTHTTVIHQLDKALAKLGIGQLTAQEVKSACYLRGLNSTHIGEDRCRTWLGEWLQISCSLKEAELSLLLHNVVLLSTNYLGTRR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LETMD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LETMD1 Antibody - BSA Free

• 1110019O13Rik
• Cervical cancer 1 proto-oncogene protein p40
• cervical cancer 1 protooncogene
• Cervical cancer proto-oncogene 2 protein
• DKFZp586A011
• HCCR1
• HCCR-1
• HCCR-2
• HCRR-2
• LETM1 domain containing 1
• LETM1 domain-containing protein 1
• regulator of TP53

Background

LETMD1, also known as LETM1 domain-containing protein 1, is a protein with 7 isoforms ranging from 99 amino acid and 11 kDa to 373 amino acid and 43 kDa; localizes in mitochondrion outer membrane; commonly found in kidney, liver, skeletal muscle, heart and brain; has a potential role in tumor genesis, which may result from negative regulation of the p53 tumor suppressor gene. Studies are being performed in relation to this protein and wolf-Hirsch horn syndrome, cervical cancer, cervicitis, breast cancer, leukemia/lymphoma, polyposis, pancreatic cancer, obesity, pancreatitis, leukemia, and carcinoma. This protein has been shown to interact with REEP5 protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LETMD1